Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318ZHM6

Protein Details
Accession A0A318ZHM6    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-62TPDRWKAKPKDSKLKDSKPKDSKBasic
NLS Segment(s)
PositionSequence
45-59KAKPKDSKLKDSKPK
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MRCKCQYNNDTGTDENPTTNCEMCGRELAIGVYFSEEQPTPDRWKAKPKDSKLKDSKPKDSKSEDSKASDSKSKSNDDRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.22
4 0.2
5 0.19
6 0.18
7 0.17
8 0.14
9 0.15
10 0.15
11 0.17
12 0.15
13 0.13
14 0.13
15 0.13
16 0.11
17 0.1
18 0.08
19 0.08
20 0.08
21 0.07
22 0.08
23 0.08
24 0.09
25 0.11
26 0.14
27 0.17
28 0.21
29 0.24
30 0.25
31 0.35
32 0.4
33 0.47
34 0.54
35 0.58
36 0.66
37 0.68
38 0.77
39 0.76
40 0.81
41 0.81
42 0.79
43 0.82
44 0.8
45 0.8
46 0.76
47 0.73
48 0.71
49 0.69
50 0.69
51 0.63
52 0.59
53 0.57
54 0.55
55 0.52
56 0.51
57 0.46
58 0.46
59 0.46
60 0.49