Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CQ97

Protein Details
Accession A0A319CQ97    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
277-305SELSVGSSSRKRRRLKQVVVRARRRSPVQHydrophilic
NLS Segment(s)
PositionSequence
286-301RKRRRLKQVVVRARRR
Subcellular Location(s) mito 12, plas 7, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR005645  FSH_dom  
Pfam View protein in Pfam  
PF03959  FSH1  
Amino Acid Sequences MATASNRPTENAKFRILMLHGYAQTAQTLRIKTRSLLQELTQTLTPIIQARYPGGIEYLFPDGPIDLDSNSTSITTASTSHPTNATRLAWWLNLDDTSRYIFLNDTIHYISDFLEGKPIHAIIGFSQGAALAVMLAAMCEAAADPQRLQAIQTQNLPVDTFLRSLSGQQPLEFVLSFCGFRGTMEYYSSLYTPALSTPSFHAIGVFDTMITAEESRELLEAFVAPEVRWFFGGHFVPRDAESMRQVVGFVKRVSSESAVGDTRGLRSVLRIGSGSDSELSVGSSSRKRRRLKQVVVRARRRSPVQMAWGRRDLGVRLALAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.39
4 0.35
5 0.3
6 0.31
7 0.28
8 0.28
9 0.28
10 0.23
11 0.24
12 0.21
13 0.2
14 0.2
15 0.22
16 0.24
17 0.28
18 0.3
19 0.29
20 0.37
21 0.41
22 0.41
23 0.41
24 0.39
25 0.42
26 0.41
27 0.43
28 0.35
29 0.29
30 0.24
31 0.2
32 0.2
33 0.16
34 0.16
35 0.14
36 0.15
37 0.15
38 0.17
39 0.17
40 0.16
41 0.14
42 0.13
43 0.11
44 0.12
45 0.15
46 0.13
47 0.13
48 0.13
49 0.11
50 0.11
51 0.12
52 0.11
53 0.07
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.08
64 0.1
65 0.14
66 0.15
67 0.16
68 0.2
69 0.2
70 0.21
71 0.23
72 0.21
73 0.18
74 0.2
75 0.2
76 0.18
77 0.18
78 0.17
79 0.15
80 0.15
81 0.15
82 0.13
83 0.12
84 0.13
85 0.12
86 0.11
87 0.11
88 0.1
89 0.11
90 0.13
91 0.12
92 0.13
93 0.12
94 0.13
95 0.12
96 0.12
97 0.11
98 0.12
99 0.12
100 0.09
101 0.15
102 0.15
103 0.15
104 0.15
105 0.15
106 0.12
107 0.11
108 0.12
109 0.06
110 0.12
111 0.11
112 0.1
113 0.1
114 0.1
115 0.09
116 0.09
117 0.08
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.03
129 0.05
130 0.06
131 0.06
132 0.07
133 0.08
134 0.08
135 0.09
136 0.13
137 0.16
138 0.17
139 0.19
140 0.19
141 0.18
142 0.19
143 0.18
144 0.13
145 0.11
146 0.09
147 0.08
148 0.07
149 0.08
150 0.08
151 0.1
152 0.12
153 0.16
154 0.16
155 0.15
156 0.16
157 0.15
158 0.16
159 0.14
160 0.11
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.07
167 0.07
168 0.1
169 0.11
170 0.11
171 0.12
172 0.13
173 0.13
174 0.13
175 0.13
176 0.11
177 0.09
178 0.08
179 0.07
180 0.07
181 0.08
182 0.08
183 0.08
184 0.1
185 0.14
186 0.14
187 0.13
188 0.13
189 0.11
190 0.12
191 0.12
192 0.1
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.06
202 0.06
203 0.06
204 0.06
205 0.05
206 0.05
207 0.06
208 0.05
209 0.06
210 0.07
211 0.06
212 0.09
213 0.1
214 0.1
215 0.11
216 0.11
217 0.1
218 0.17
219 0.19
220 0.19
221 0.2
222 0.21
223 0.21
224 0.21
225 0.23
226 0.17
227 0.17
228 0.17
229 0.16
230 0.16
231 0.15
232 0.15
233 0.16
234 0.19
235 0.21
236 0.19
237 0.19
238 0.19
239 0.21
240 0.23
241 0.22
242 0.2
243 0.17
244 0.2
245 0.19
246 0.18
247 0.18
248 0.16
249 0.16
250 0.16
251 0.15
252 0.12
253 0.13
254 0.18
255 0.17
256 0.18
257 0.17
258 0.16
259 0.19
260 0.19
261 0.19
262 0.14
263 0.13
264 0.12
265 0.12
266 0.11
267 0.08
268 0.09
269 0.12
270 0.19
271 0.28
272 0.37
273 0.46
274 0.54
275 0.64
276 0.74
277 0.81
278 0.85
279 0.86
280 0.88
281 0.9
282 0.93
283 0.93
284 0.9
285 0.86
286 0.83
287 0.77
288 0.74
289 0.71
290 0.68
291 0.68
292 0.68
293 0.68
294 0.68
295 0.68
296 0.61
297 0.54
298 0.49
299 0.4
300 0.37
301 0.33