Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CFB4

Protein Details
Accession A0A319CFB4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKKPEQREIIRNKKNKRLFIFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 6, vacu 2, mito 1, extr 1, pero 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKKPEQREIIRNKKNKRLFIFLLFLTAAHPVAGGYYTSVQCSRSDRSVLFLILSGICVDLLFFLSLLGLFVVVFLFQSMQRDEVLRIGGHKLGVSVLFYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.77
4 0.75
5 0.69
6 0.66
7 0.62
8 0.51
9 0.45
10 0.36
11 0.3
12 0.22
13 0.18
14 0.12
15 0.08
16 0.08
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.07
23 0.08
24 0.09
25 0.1
26 0.11
27 0.12
28 0.15
29 0.17
30 0.17
31 0.19
32 0.18
33 0.21
34 0.21
35 0.2
36 0.16
37 0.13
38 0.12
39 0.09
40 0.09
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.04
63 0.05
64 0.08
65 0.08
66 0.1
67 0.11
68 0.12
69 0.13
70 0.14
71 0.16
72 0.14
73 0.15
74 0.16
75 0.17
76 0.16
77 0.15
78 0.13
79 0.13
80 0.13