Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CQH9

Protein Details
Accession A0A319CQH9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
69-93RDTHGRSKKSGRIQKNKKNRSSIVFHydrophilic
NLS Segment(s)
PositionSequence
72-107HGRSKKSGRIQKNKKNRSSIVFRPHPSKAKRMSRKK
Subcellular Location(s) mito 17.5, mito_nucl 13.833, nucl 9, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSGRASVIKRNRANLRATVFGPAVDARTERLSAKLQELAAQPKPTEGNSKMEMDSTRSDMDIDQKPRDTHGRSKKSGRIQKNKKNRSSIVFRPHPSKAKRMSRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.62
4 0.56
5 0.5
6 0.47
7 0.41
8 0.33
9 0.28
10 0.25
11 0.19
12 0.16
13 0.13
14 0.12
15 0.11
16 0.12
17 0.14
18 0.12
19 0.15
20 0.17
21 0.18
22 0.2
23 0.21
24 0.19
25 0.22
26 0.23
27 0.25
28 0.25
29 0.25
30 0.22
31 0.21
32 0.22
33 0.19
34 0.22
35 0.19
36 0.21
37 0.22
38 0.23
39 0.22
40 0.22
41 0.22
42 0.19
43 0.18
44 0.16
45 0.14
46 0.12
47 0.12
48 0.12
49 0.17
50 0.2
51 0.23
52 0.23
53 0.26
54 0.26
55 0.29
56 0.35
57 0.33
58 0.37
59 0.44
60 0.51
61 0.53
62 0.6
63 0.65
64 0.69
65 0.74
66 0.75
67 0.75
68 0.78
69 0.83
70 0.87
71 0.9
72 0.87
73 0.87
74 0.81
75 0.78
76 0.76
77 0.75
78 0.74
79 0.73
80 0.69
81 0.66
82 0.68
83 0.69
84 0.66
85 0.65
86 0.65
87 0.68