Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N3T4

Protein Details
Accession A8N3T4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-58MSRPKKYATKAERKAANREKNKRYYAKNKDEINKRRKETRASIKARDRRQKVCNKAKAHydrophilic
NLS Segment(s)
PositionSequence
4-51PKKYATKAERKAANREKNKRYYAKNKDEINKRRKETRASIKARDRRQK
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
KEGG cci:CC1G_00605  -  
Amino Acid Sequences MSRPKKYATKAERKAANREKNKRYYAKNKDEINKRRKETRASIKARDRRQKVCNKAKASVQHTKPVITETEDSRVKISTEAALAPYRAFKCLVGDAPFEYHNSFCKYLIELAKQGEDWRNEILSAHQTLLQVCGIGPEFRKVDAMLKDVQEAIANVEDIEVHLLGTFDDFLTAFQSGYLLFQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.79
5 0.81
6 0.82
7 0.82
8 0.87
9 0.84
10 0.84
11 0.84
12 0.84
13 0.85
14 0.83
15 0.82
16 0.82
17 0.85
18 0.85
19 0.84
20 0.83
21 0.77
22 0.78
23 0.75
24 0.74
25 0.73
26 0.74
27 0.75
28 0.73
29 0.77
30 0.78
31 0.81
32 0.82
33 0.82
34 0.77
35 0.74
36 0.77
37 0.78
38 0.78
39 0.81
40 0.8
41 0.74
42 0.71
43 0.69
44 0.67
45 0.64
46 0.63
47 0.55
48 0.53
49 0.49
50 0.47
51 0.42
52 0.35
53 0.29
54 0.22
55 0.22
56 0.16
57 0.22
58 0.22
59 0.22
60 0.21
61 0.2
62 0.18
63 0.16
64 0.15
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.09
72 0.12
73 0.12
74 0.12
75 0.12
76 0.1
77 0.11
78 0.12
79 0.14
80 0.12
81 0.12
82 0.12
83 0.13
84 0.13
85 0.13
86 0.12
87 0.1
88 0.11
89 0.14
90 0.15
91 0.13
92 0.14
93 0.14
94 0.18
95 0.21
96 0.2
97 0.19
98 0.19
99 0.19
100 0.19
101 0.2
102 0.2
103 0.18
104 0.17
105 0.17
106 0.16
107 0.15
108 0.15
109 0.15
110 0.14
111 0.14
112 0.13
113 0.14
114 0.14
115 0.14
116 0.15
117 0.13
118 0.1
119 0.09
120 0.1
121 0.09
122 0.1
123 0.11
124 0.13
125 0.14
126 0.14
127 0.16
128 0.15
129 0.2
130 0.21
131 0.23
132 0.22
133 0.22
134 0.23
135 0.22
136 0.21
137 0.16
138 0.14
139 0.13
140 0.11
141 0.1
142 0.09
143 0.09
144 0.08
145 0.08
146 0.09
147 0.07
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.05
155 0.06
156 0.06
157 0.06
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08