Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319C1T2

Protein Details
Accession A0A319C1T2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
192-224LGQKRRPNKAHAQIRERERREKGNRFRERPGDEBasic
NLS Segment(s)
PositionSequence
195-219KRRPNKAHAQIRERERREKGNRFRE
Subcellular Location(s) nucl 16, cyto_nucl 12.333, mito_nucl 11.499, mito 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MEPPLSRTTSVRISLISYGHANGPMIQQSREVRYRQTLAYNIRHLPNPPRHLRVNATGLSRRLQKEFLQNDAVEAVLVKVQQEIVNAVQEGCAQSLYSLQPEDLRQDASQTDTRRSLDSQASGKPAVDGIDVDIVVTICCEEGRHRSVAFVEELARRLATIKDGDGVLQHWALNLNKRHRDIEDGEDSEQSLGQKRRPNKAHAQIRERERREKGNRFRERPGDEDDTDQIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.25
4 0.2
5 0.19
6 0.19
7 0.19
8 0.17
9 0.15
10 0.17
11 0.2
12 0.21
13 0.2
14 0.24
15 0.26
16 0.33
17 0.37
18 0.37
19 0.35
20 0.4
21 0.43
22 0.4
23 0.42
24 0.42
25 0.44
26 0.49
27 0.49
28 0.47
29 0.46
30 0.46
31 0.44
32 0.47
33 0.48
34 0.5
35 0.51
36 0.52
37 0.53
38 0.55
39 0.57
40 0.53
41 0.5
42 0.44
43 0.43
44 0.42
45 0.4
46 0.39
47 0.41
48 0.37
49 0.33
50 0.33
51 0.32
52 0.38
53 0.39
54 0.39
55 0.37
56 0.34
57 0.32
58 0.3
59 0.25
60 0.15
61 0.12
62 0.08
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.05
81 0.05
82 0.07
83 0.07
84 0.08
85 0.07
86 0.07
87 0.09
88 0.09
89 0.11
90 0.1
91 0.11
92 0.1
93 0.11
94 0.11
95 0.13
96 0.17
97 0.17
98 0.19
99 0.19
100 0.2
101 0.21
102 0.21
103 0.21
104 0.19
105 0.2
106 0.2
107 0.19
108 0.21
109 0.2
110 0.19
111 0.15
112 0.14
113 0.11
114 0.09
115 0.07
116 0.05
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.03
126 0.03
127 0.04
128 0.05
129 0.1
130 0.13
131 0.15
132 0.15
133 0.16
134 0.17
135 0.19
136 0.18
137 0.14
138 0.14
139 0.13
140 0.15
141 0.14
142 0.13
143 0.11
144 0.12
145 0.12
146 0.11
147 0.11
148 0.1
149 0.11
150 0.12
151 0.12
152 0.11
153 0.11
154 0.1
155 0.1
156 0.09
157 0.08
158 0.11
159 0.13
160 0.2
161 0.26
162 0.33
163 0.39
164 0.42
165 0.45
166 0.43
167 0.47
168 0.44
169 0.44
170 0.43
171 0.39
172 0.37
173 0.35
174 0.34
175 0.28
176 0.25
177 0.19
178 0.19
179 0.2
180 0.24
181 0.31
182 0.38
183 0.48
184 0.53
185 0.6
186 0.63
187 0.7
188 0.75
189 0.77
190 0.79
191 0.77
192 0.81
193 0.84
194 0.79
195 0.78
196 0.74
197 0.75
198 0.77
199 0.79
200 0.8
201 0.8
202 0.85
203 0.82
204 0.85
205 0.84
206 0.79
207 0.72
208 0.69
209 0.65
210 0.56
211 0.54