Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319BSF3

Protein Details
Accession A0A319BSF3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
11-43NETKLPKVPNSPKKVVRQKRDRRKKSLIHKAYEHydrophilic
NLS Segment(s)
PositionSequence
19-36PNSPKKVVRQKRDRRKKS
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MFFFVTMSEDNETKLPKVPNSPKKVVRQKRDRRKKSLIHKAYEYSKLCDADIYLGIRLRDSGQVTTFQADPTGFWSRFSSHLEGYYPRPVQKTDKDFDELAAGESAGEEDKIKPLEDKAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.25
4 0.35
5 0.44
6 0.52
7 0.59
8 0.66
9 0.67
10 0.75
11 0.82
12 0.82
13 0.82
14 0.83
15 0.86
16 0.89
17 0.93
18 0.92
19 0.9
20 0.9
21 0.88
22 0.88
23 0.88
24 0.85
25 0.79
26 0.73
27 0.68
28 0.63
29 0.62
30 0.53
31 0.44
32 0.4
33 0.35
34 0.31
35 0.26
36 0.22
37 0.15
38 0.15
39 0.12
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.1
50 0.12
51 0.13
52 0.14
53 0.13
54 0.1
55 0.1
56 0.09
57 0.08
58 0.11
59 0.17
60 0.15
61 0.16
62 0.18
63 0.19
64 0.22
65 0.25
66 0.24
67 0.19
68 0.2
69 0.21
70 0.22
71 0.24
72 0.29
73 0.27
74 0.27
75 0.28
76 0.29
77 0.34
78 0.4
79 0.44
80 0.4
81 0.42
82 0.44
83 0.42
84 0.4
85 0.36
86 0.27
87 0.22
88 0.18
89 0.14
90 0.1
91 0.09
92 0.09
93 0.07
94 0.07
95 0.07
96 0.07
97 0.12
98 0.13
99 0.14
100 0.16
101 0.17