Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CPI3

Protein Details
Accession A0A319CPI3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
254-280GHGHGHHHHHHHHRHHRSSSRRSGSREBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 15, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008816  Gly_zipper_2TM_dom  
IPR002395  Kininogen  
Gene Ontology GO:0019867  C:outer membrane  
Pfam View protein in Pfam  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MGDPYSTSSPPPPAQQQPQQSDYDYNYNYHYNAPPPTASSSSAYHDQYPPTYQQQHYGHTSQYDVSQIPRSHPDEAGGALVPGPDQQQHYDYDHDRLGPQYEPPPPPPPHGYGIVRQGSNAEYYNQSHHDDLSQSQNPPPSQPDDEGVGPESTDRGLGGAILGGTAGYYLGHKKSHGLLGAVGGAILGSLMENKLKGAGRKEDHGGGGAAGGSHYSGSDDERGSHYSHGHSHRSSHSHSHSHSHSHHRHEHGHGHGHGHHHHHHHHRHHRSSSRRSGSREGEGEGYGYGSREGEGEGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.64
4 0.64
5 0.66
6 0.63
7 0.57
8 0.53
9 0.48
10 0.48
11 0.4
12 0.34
13 0.33
14 0.32
15 0.31
16 0.31
17 0.3
18 0.26
19 0.28
20 0.29
21 0.27
22 0.28
23 0.32
24 0.29
25 0.29
26 0.27
27 0.26
28 0.28
29 0.33
30 0.32
31 0.31
32 0.31
33 0.31
34 0.3
35 0.31
36 0.31
37 0.33
38 0.38
39 0.35
40 0.42
41 0.43
42 0.45
43 0.47
44 0.45
45 0.39
46 0.34
47 0.34
48 0.26
49 0.23
50 0.21
51 0.16
52 0.17
53 0.22
54 0.22
55 0.24
56 0.3
57 0.32
58 0.32
59 0.31
60 0.3
61 0.24
62 0.23
63 0.22
64 0.15
65 0.11
66 0.09
67 0.09
68 0.07
69 0.07
70 0.07
71 0.07
72 0.09
73 0.11
74 0.12
75 0.15
76 0.17
77 0.21
78 0.22
79 0.23
80 0.23
81 0.22
82 0.21
83 0.19
84 0.19
85 0.15
86 0.16
87 0.18
88 0.23
89 0.25
90 0.28
91 0.35
92 0.35
93 0.38
94 0.4
95 0.38
96 0.35
97 0.38
98 0.36
99 0.31
100 0.37
101 0.36
102 0.32
103 0.29
104 0.27
105 0.22
106 0.21
107 0.18
108 0.12
109 0.11
110 0.12
111 0.15
112 0.17
113 0.18
114 0.16
115 0.16
116 0.15
117 0.14
118 0.15
119 0.19
120 0.2
121 0.19
122 0.2
123 0.24
124 0.23
125 0.23
126 0.24
127 0.21
128 0.2
129 0.2
130 0.19
131 0.18
132 0.18
133 0.17
134 0.16
135 0.12
136 0.1
137 0.09
138 0.08
139 0.05
140 0.05
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.03
156 0.05
157 0.07
158 0.07
159 0.08
160 0.1
161 0.12
162 0.14
163 0.15
164 0.14
165 0.12
166 0.12
167 0.13
168 0.11
169 0.09
170 0.06
171 0.04
172 0.03
173 0.03
174 0.02
175 0.02
176 0.02
177 0.03
178 0.03
179 0.04
180 0.04
181 0.08
182 0.1
183 0.13
184 0.17
185 0.24
186 0.26
187 0.29
188 0.32
189 0.31
190 0.29
191 0.27
192 0.23
193 0.15
194 0.13
195 0.1
196 0.07
197 0.05
198 0.05
199 0.04
200 0.03
201 0.03
202 0.04
203 0.05
204 0.06
205 0.09
206 0.1
207 0.11
208 0.14
209 0.16
210 0.16
211 0.18
212 0.18
213 0.18
214 0.25
215 0.29
216 0.32
217 0.31
218 0.35
219 0.39
220 0.42
221 0.44
222 0.45
223 0.46
224 0.47
225 0.48
226 0.5
227 0.47
228 0.5
229 0.51
230 0.54
231 0.54
232 0.56
233 0.61
234 0.6
235 0.63
236 0.61
237 0.63
238 0.58
239 0.59
240 0.53
241 0.49
242 0.46
243 0.45
244 0.44
245 0.43
246 0.43
247 0.41
248 0.48
249 0.54
250 0.61
251 0.66
252 0.73
253 0.78
254 0.81
255 0.85
256 0.86
257 0.86
258 0.87
259 0.87
260 0.86
261 0.83
262 0.8
263 0.79
264 0.75
265 0.73
266 0.65
267 0.57
268 0.49
269 0.42
270 0.37
271 0.28
272 0.23
273 0.15
274 0.14
275 0.11
276 0.09
277 0.09
278 0.09
279 0.1