Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CRK4

Protein Details
Accession A0A319CRK4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-105KDSDLNKARKRAKDKQKNNFSRSPSDHydrophilic
NLS Segment(s)
PositionSequence
86-95KARKRAKDKQ
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MDCFAATLAWKWFKKWVTITKSTSQNEEIIIFADVERGPDNIVEEFKKFGNSATLTVVKAGWNCFSLDQLAESIHKGRFKDSDLNKARKRAKDKQKNNFSRSPSDPISRFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.49
4 0.49
5 0.57
6 0.61
7 0.61
8 0.68
9 0.63
10 0.59
11 0.51
12 0.44
13 0.36
14 0.31
15 0.24
16 0.16
17 0.15
18 0.11
19 0.09
20 0.1
21 0.08
22 0.09
23 0.09
24 0.08
25 0.08
26 0.08
27 0.1
28 0.08
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.12
35 0.11
36 0.1
37 0.13
38 0.13
39 0.13
40 0.15
41 0.16
42 0.15
43 0.15
44 0.15
45 0.11
46 0.11
47 0.11
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.11
61 0.13
62 0.15
63 0.15
64 0.17
65 0.19
66 0.22
67 0.31
68 0.32
69 0.4
70 0.46
71 0.56
72 0.58
73 0.65
74 0.69
75 0.68
76 0.73
77 0.73
78 0.76
79 0.77
80 0.84
81 0.86
82 0.89
83 0.91
84 0.89
85 0.87
86 0.81
87 0.77
88 0.72
89 0.69
90 0.63
91 0.61