Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DCU8

Protein Details
Accession A0A319DCU8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-98DVICKRRRSNDSRKIAHLRRRRTDQGBasic
NLS Segment(s)
PositionSequence
84-93SRKIAHLRRR
Subcellular Location(s) mito_nucl 10.666, nucl 10.5, mito 10.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MHPSKRVGPCPSCKSPSIPGLYIAGQHCTSLVSSFAATETGFDRFHLLSETMTTETWHSLVTSSKKGRAFSCDVICKRRRSNDSRKIAHLRRRRTDQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.56
4 0.52
5 0.44
6 0.37
7 0.36
8 0.34
9 0.33
10 0.27
11 0.23
12 0.18
13 0.17
14 0.15
15 0.13
16 0.13
17 0.09
18 0.09
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.06
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.1
31 0.1
32 0.1
33 0.11
34 0.1
35 0.08
36 0.08
37 0.1
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.06
46 0.06
47 0.11
48 0.14
49 0.21
50 0.23
51 0.28
52 0.31
53 0.33
54 0.34
55 0.36
56 0.38
57 0.37
58 0.42
59 0.46
60 0.47
61 0.53
62 0.58
63 0.58
64 0.6
65 0.63
66 0.65
67 0.66
68 0.73
69 0.75
70 0.8
71 0.78
72 0.8
73 0.81
74 0.81
75 0.81
76 0.79
77 0.79
78 0.79