Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CJ93

Protein Details
Accession A0A319CJ93    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSSRKSSNRPKKRVLSVKIPWTEHydrophilic
119-140ASKSRKKRTNTAGSRARRKRKPBasic
NLS Segment(s)
PositionSequence
46-63RSRRVAAGKPVPPPLRRG
118-140RASKSRKKRTNTAGSRARRKRKP
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSSSRKSSNRPKKRVLSVKIPWTEVASTMGHNVTEGAIVQHLAKLRSRRVAAGKPVPPPLRRGGLGAAIKPIGLPSGKNTPDSKPQRVIAGTNHNGETGASDFADVDSSSDEDYVEGRASKSRKKRTNTAGSRARRKRKPVVKLEHDTDGYDSDEEDEDDSLLVPGAEFLDCPNSMSSPPGRQLGSPEDDQPRKIIVLKYARPANQASTGDISEPVLGSTSNDAFIASGYTLQQQPAGAGQFPLQSQTPSANLSDTFYANAVSSTENNMHLEPGDPGHHPSTLWFDDATLGYPNAVYHGLSNPDLDIDFSGNHISNTDQQFDHLLGYDDDLVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.86
4 0.83
5 0.84
6 0.78
7 0.71
8 0.61
9 0.53
10 0.46
11 0.37
12 0.31
13 0.22
14 0.18
15 0.19
16 0.18
17 0.15
18 0.14
19 0.13
20 0.1
21 0.09
22 0.09
23 0.07
24 0.07
25 0.08
26 0.08
27 0.1
28 0.12
29 0.14
30 0.19
31 0.24
32 0.29
33 0.36
34 0.38
35 0.42
36 0.47
37 0.53
38 0.57
39 0.6
40 0.6
41 0.57
42 0.64
43 0.64
44 0.58
45 0.54
46 0.51
47 0.46
48 0.42
49 0.39
50 0.33
51 0.34
52 0.36
53 0.32
54 0.29
55 0.23
56 0.22
57 0.2
58 0.18
59 0.12
60 0.1
61 0.09
62 0.11
63 0.2
64 0.22
65 0.26
66 0.28
67 0.3
68 0.4
69 0.47
70 0.5
71 0.46
72 0.46
73 0.47
74 0.46
75 0.45
76 0.4
77 0.43
78 0.4
79 0.37
80 0.36
81 0.31
82 0.3
83 0.27
84 0.22
85 0.14
86 0.11
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.07
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.12
106 0.15
107 0.23
108 0.32
109 0.42
110 0.49
111 0.55
112 0.63
113 0.69
114 0.77
115 0.77
116 0.77
117 0.76
118 0.76
119 0.81
120 0.81
121 0.81
122 0.76
123 0.76
124 0.77
125 0.76
126 0.78
127 0.78
128 0.79
129 0.78
130 0.77
131 0.72
132 0.65
133 0.57
134 0.47
135 0.37
136 0.28
137 0.2
138 0.14
139 0.11
140 0.08
141 0.08
142 0.07
143 0.07
144 0.06
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.06
158 0.06
159 0.07
160 0.07
161 0.07
162 0.08
163 0.1
164 0.11
165 0.12
166 0.14
167 0.16
168 0.16
169 0.15
170 0.18
171 0.21
172 0.22
173 0.21
174 0.23
175 0.27
176 0.28
177 0.28
178 0.26
179 0.23
180 0.2
181 0.22
182 0.19
183 0.2
184 0.27
185 0.29
186 0.34
187 0.38
188 0.38
189 0.38
190 0.37
191 0.33
192 0.31
193 0.29
194 0.24
195 0.22
196 0.21
197 0.19
198 0.18
199 0.16
200 0.1
201 0.09
202 0.07
203 0.06
204 0.05
205 0.05
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.05
215 0.06
216 0.06
217 0.08
218 0.09
219 0.09
220 0.1
221 0.09
222 0.09
223 0.11
224 0.12
225 0.1
226 0.09
227 0.1
228 0.11
229 0.11
230 0.13
231 0.12
232 0.11
233 0.12
234 0.13
235 0.13
236 0.13
237 0.14
238 0.13
239 0.13
240 0.14
241 0.15
242 0.14
243 0.13
244 0.11
245 0.11
246 0.1
247 0.1
248 0.09
249 0.09
250 0.09
251 0.12
252 0.13
253 0.15
254 0.16
255 0.16
256 0.16
257 0.14
258 0.15
259 0.12
260 0.13
261 0.13
262 0.13
263 0.16
264 0.18
265 0.18
266 0.17
267 0.17
268 0.22
269 0.21
270 0.21
271 0.18
272 0.16
273 0.18
274 0.19
275 0.19
276 0.14
277 0.13
278 0.11
279 0.12
280 0.11
281 0.11
282 0.11
283 0.1
284 0.09
285 0.13
286 0.16
287 0.17
288 0.17
289 0.15
290 0.16
291 0.16
292 0.15
293 0.12
294 0.1
295 0.1
296 0.11
297 0.14
298 0.13
299 0.13
300 0.13
301 0.14
302 0.2
303 0.24
304 0.26
305 0.23
306 0.24
307 0.26
308 0.26
309 0.24
310 0.18
311 0.17
312 0.14
313 0.16