Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319BZV1

Protein Details
Accession A0A319BZV1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-30FPCNPTPRQRHRLLPRHRSPASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MLFLSSLFFPCNPTPRQRHRLLPRHRSPASGSRTGNRDCELTSHSVIRAAKFLVTSVPLLAYLLTQRTAQRHRLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.6
4 0.61
5 0.67
6 0.72
7 0.78
8 0.8
9 0.81
10 0.8
11 0.81
12 0.76
13 0.68
14 0.62
15 0.61
16 0.56
17 0.52
18 0.45
19 0.39
20 0.43
21 0.42
22 0.39
23 0.31
24 0.26
25 0.19
26 0.19
27 0.18
28 0.16
29 0.16
30 0.15
31 0.14
32 0.18
33 0.18
34 0.17
35 0.16
36 0.14
37 0.13
38 0.12
39 0.12
40 0.1
41 0.1
42 0.1
43 0.09
44 0.09
45 0.08
46 0.08
47 0.08
48 0.07
49 0.08
50 0.09
51 0.1
52 0.12
53 0.15
54 0.23
55 0.29