FuNGI

A0A319BWA4

Protein Details

Accession

A0A319BWA4

Localization Confidence

High

Confidence Score

20.1

NoLS Segment(s)

Position	Sequence	Protein Nature
65-95	STSNPSRPPDNARHDKKKRKHASPHGPSDNL	Hydrophilic
391-416	EGAPVWKKKGQKRTTRKVRMKPVVAT	Hydrophilic
532-574	QTQAKDTEPKQPRARKVNPQAHANYRSLKIRNKNFKGRGGGRF	Hydrophilic

NLS Segment(s)

Position	Sequence
76-86	ARHDKKKRKHA
397-410	KKKGQKRTTRKVRM
525-530	EKPPVR
536-578	KDTEPKQPRARKVNPQAHANYRSLKIRNKNFKGRGGGRFGRRR

Subcellular Location(s)

nucl 13.5, mito_nucl 9.833, cyto 8.5, cyto_mito 7.333, mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR021110 DNA_rep_checkpnt_protein IPR040203 Sld2
Gene Ontology	GO:0005634 C:nucleus GO:0007049 P:cell cycle GO:0006270 P:DNA replication initiation
Pfam	View protein in Pfam PF11719 Drc1-Sld2
CDD	cd22289 RecQL4_SLD2_NTD

Amino Acid Sequences

MATAIISSTATPSSADLRAELKEWERAFADANGGRKADRSDIKKVPEIAAKYKEYSRLKALETSSTSNPSRPPDNARHDKKKRKHASPHGPSDNLLTTTPRKKTDNGGAAGAFETPSRKTTSHPAEVDPYDSPSVLRRLFSPSTHLSPLKAAIGPTPQRDGKALGLFDLLSESGGSTATPSATRLASLKDANVRTPSRRTKTQKMKRGTMMDTIAEEEGEEAAREGVEDSEDDDESSRLGRTPTSSGKKWMLSTLFATPTTWRYATMMDDGSNKGTAAAGAGIAVAGEVAEGASVAAVEEPNGSETPSFLRRSTSGRYDTSTITGGLSPMATRKRPQFVGKGLSALMKGLRDMEEEQMEDDMDVLREIEAEQAAMMDAQVADSQAAAAENEGAPVWKKKGQKRTTRKVRMKPVVATSRQSAPELPSFSDEEDEEEGEEDDGPDGGVTAVRETQQLVASGPLDRSHTEVPDLDDLDSLHTMSEPDLSDFDPDYDEGPQPRGKSKSFSEKMKEAIAAGKPPATEPPEKPPVRPQTQAKDTEPKQPRARKVNPQAHANYRSLKIRNKNFKGRGGGRFGRRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.17
3	0.17
4	0.19
5	0.2
6	0.21
7	0.24
8	0.22
9	0.27
10	0.27
11	0.29
12	0.27
13	0.27
14	0.28
15	0.25
16	0.3
17	0.25
18	0.28
19	0.28
20	0.28
21	0.27
22	0.27
23	0.29
24	0.29
25	0.35
26	0.37
27	0.43
28	0.49
29	0.55
30	0.59
31	0.58
32	0.55
33	0.54
34	0.53
35	0.52
36	0.52
37	0.49
38	0.47
39	0.48
40	0.52
41	0.5
42	0.5
43	0.49
44	0.46
45	0.46
46	0.48
47	0.47
48	0.45
49	0.44
50	0.44
51	0.41
52	0.42
53	0.41
54	0.38
55	0.4
56	0.38
57	0.38
58	0.37
59	0.42
60	0.46
61	0.55
62	0.63
63	0.69
64	0.75
65	0.81
66	0.88
67	0.89
68	0.91
69	0.91
70	0.9
71	0.91
72	0.91
73	0.92
74	0.91
75	0.92
76	0.88
77	0.79
78	0.69
79	0.62
80	0.54
81	0.45
82	0.35
83	0.29
84	0.29
85	0.35
86	0.4
87	0.4
88	0.4
89	0.41
90	0.48
91	0.54
92	0.55
93	0.49
94	0.47
95	0.42
96	0.4
97	0.37
98	0.3
99	0.2
100	0.12
101	0.12
102	0.1
103	0.12
104	0.15
105	0.15
106	0.18
107	0.27
108	0.35
109	0.42
110	0.42
111	0.43
112	0.45
113	0.46
114	0.46
115	0.36
116	0.31
117	0.24
118	0.22
119	0.19
120	0.17
121	0.22
122	0.2
123	0.2
124	0.18
125	0.24
126	0.27
127	0.27
128	0.3
129	0.29
130	0.32
131	0.37
132	0.36
133	0.3
134	0.29
135	0.3
136	0.26
137	0.22
138	0.18
139	0.15
140	0.22
141	0.25
142	0.25
143	0.29
144	0.28
145	0.28
146	0.29
147	0.29
148	0.26
149	0.26
150	0.24
151	0.19
152	0.19
153	0.17
154	0.16
155	0.14
156	0.1
157	0.06
158	0.06
159	0.05
160	0.04
161	0.05
162	0.05
163	0.04
164	0.05
165	0.06
166	0.06
167	0.07
168	0.09
169	0.09
170	0.1
171	0.1
172	0.11
173	0.15
174	0.15
175	0.17
176	0.21
177	0.23
178	0.24
179	0.29
180	0.3
181	0.3
182	0.38
183	0.45
184	0.44
185	0.53
186	0.59
187	0.64
188	0.72
189	0.79
190	0.79
191	0.77
192	0.79
193	0.75
194	0.73
195	0.65
196	0.58
197	0.5
198	0.42
199	0.34
200	0.28
201	0.22
202	0.16
203	0.13
204	0.08
205	0.06
206	0.05
207	0.05
208	0.04
209	0.04
210	0.04
211	0.04
212	0.04
213	0.04
214	0.04
215	0.04
216	0.05
217	0.06
218	0.07
219	0.07
220	0.07
221	0.07
222	0.07
223	0.07
224	0.07
225	0.06
226	0.07
227	0.07
228	0.09
229	0.13
230	0.22
231	0.27
232	0.28
233	0.32
234	0.35
235	0.36
236	0.35
237	0.34
238	0.27
239	0.23
240	0.24
241	0.22
242	0.2
243	0.18
244	0.18
245	0.15
246	0.16
247	0.17
248	0.15
249	0.12
250	0.12
251	0.12
252	0.13
253	0.14
254	0.13
255	0.11
256	0.13
257	0.13
258	0.13
259	0.12
260	0.11
261	0.08
262	0.07
263	0.06
264	0.05
265	0.04
266	0.03
267	0.03
268	0.03
269	0.03
270	0.02
271	0.02
272	0.02
273	0.02
274	0.01
275	0.01
276	0.01
277	0.01
278	0.01
279	0.01
280	0.01
281	0.02
282	0.02
283	0.02
284	0.02
285	0.02
286	0.03
287	0.03
288	0.04
289	0.05
290	0.05
291	0.05
292	0.05
293	0.08
294	0.12
295	0.14
296	0.13
297	0.15
298	0.16
299	0.2
300	0.24
301	0.27
302	0.27
303	0.27
304	0.29
305	0.29
306	0.28
307	0.26
308	0.23
309	0.17
310	0.13
311	0.12
312	0.1
313	0.08
314	0.07
315	0.06
316	0.09
317	0.12
318	0.13
319	0.16
320	0.21
321	0.26
322	0.29
323	0.33
324	0.36
325	0.38
326	0.42
327	0.39
328	0.35
329	0.31
330	0.28
331	0.24
332	0.18
333	0.14
334	0.09
335	0.08
336	0.08
337	0.08
338	0.09
339	0.1
340	0.12
341	0.12
342	0.12
343	0.12
344	0.11
345	0.11
346	0.09
347	0.08
348	0.06
349	0.05
350	0.05
351	0.04
352	0.04
353	0.04
354	0.04
355	0.05
356	0.05
357	0.05
358	0.04
359	0.04
360	0.04
361	0.04
362	0.04
363	0.03
364	0.03
365	0.03
366	0.04
367	0.04
368	0.04
369	0.04
370	0.04
371	0.04
372	0.04
373	0.04
374	0.04
375	0.04
376	0.04
377	0.05
378	0.05
379	0.05
380	0.07
381	0.09
382	0.12
383	0.17
384	0.24
385	0.32
386	0.43
387	0.52
388	0.62
389	0.7
390	0.79
391	0.85
392	0.89
393	0.91
394	0.9
395	0.91
396	0.89
397	0.84
398	0.78
399	0.75
400	0.73
401	0.66
402	0.6
403	0.51
404	0.48
405	0.44
406	0.4
407	0.32
408	0.27
409	0.28
410	0.28
411	0.26
412	0.23
413	0.22
414	0.22
415	0.22
416	0.18
417	0.16
418	0.15
419	0.14
420	0.12
421	0.11
422	0.11
423	0.1
424	0.1
425	0.07
426	0.06
427	0.06
428	0.06
429	0.05
430	0.04
431	0.04
432	0.05
433	0.05
434	0.06
435	0.07
436	0.08
437	0.09
438	0.1
439	0.12
440	0.12
441	0.13
442	0.12
443	0.12
444	0.13
445	0.14
446	0.14
447	0.13
448	0.14
449	0.13
450	0.17
451	0.18
452	0.18
453	0.19
454	0.2
455	0.22
456	0.23
457	0.24
458	0.2
459	0.18
460	0.18
461	0.18
462	0.17
463	0.13
464	0.09
465	0.08
466	0.08
467	0.08
468	0.11
469	0.09
470	0.1
471	0.12
472	0.12
473	0.14
474	0.14
475	0.14
476	0.13
477	0.12
478	0.12
479	0.14
480	0.16
481	0.16
482	0.19
483	0.22
484	0.23
485	0.29
486	0.33
487	0.33
488	0.36
489	0.42
490	0.49
491	0.53
492	0.6
493	0.6
494	0.59
495	0.6
496	0.57
497	0.51
498	0.41
499	0.4
500	0.34
501	0.31
502	0.28
503	0.27
504	0.23
505	0.24
506	0.29
507	0.28
508	0.31
509	0.31
510	0.38
511	0.47
512	0.48
513	0.5
514	0.54
515	0.59
516	0.59
517	0.64
518	0.64
519	0.64
520	0.71
521	0.75
522	0.71
523	0.71
524	0.67
525	0.7
526	0.7
527	0.69
528	0.7
529	0.72
530	0.76
531	0.76
532	0.83
533	0.83
534	0.85
535	0.86
536	0.82
537	0.82
538	0.8
539	0.79
540	0.75
541	0.68
542	0.63
543	0.58
544	0.6
545	0.58
546	0.59
547	0.6
548	0.66
549	0.73
550	0.76
551	0.83
552	0.82
553	0.83
554	0.84
555	0.83
556	0.8
557	0.78
558	0.77

A0A319BWA4

3D AlphaFold-predicted Structure Viewer