Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319BYA0

Protein Details
Accession A0A319BYA0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
182-208ATPKVDKQEKAKQPKGRAYKRVVYTRRHydrophilic
NLS Segment(s)
PositionSequence
174-201ARAGKVKAATPKVDKQEKAKQPKGRAYK
Subcellular Location(s) plas 17, mito 5, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MPSGLLIAQLAVYTPLTLPTLYLLFCYGRHGPLAWFYYLAFCVLRVTGAAMGLHDPHNTGAQIISGIELSQLLLSIDGVLHEARIYWLSPSKRTEWTFMALIHVLVATGVAMVGADAGGLRGDTPKPSDLSNIKVGMVLLEAAWGMLALLGLWTLWNGRGAPAGLARREGWLLARAGKVKAATPKVDKQEKAKQPKGRAYKRVVYTRRFVNVTLTGGKRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.09
6 0.1
7 0.11
8 0.1
9 0.11
10 0.11
11 0.11
12 0.12
13 0.17
14 0.17
15 0.17
16 0.18
17 0.18
18 0.17
19 0.23
20 0.25
21 0.21
22 0.19
23 0.18
24 0.19
25 0.18
26 0.18
27 0.12
28 0.09
29 0.1
30 0.09
31 0.09
32 0.07
33 0.08
34 0.07
35 0.08
36 0.08
37 0.07
38 0.08
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.11
45 0.1
46 0.1
47 0.08
48 0.07
49 0.08
50 0.07
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.06
74 0.12
75 0.14
76 0.18
77 0.21
78 0.23
79 0.29
80 0.31
81 0.33
82 0.29
83 0.3
84 0.28
85 0.25
86 0.24
87 0.17
88 0.15
89 0.12
90 0.09
91 0.06
92 0.04
93 0.04
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.01
100 0.02
101 0.01
102 0.01
103 0.01
104 0.02
105 0.02
106 0.02
107 0.02
108 0.04
109 0.04
110 0.05
111 0.07
112 0.09
113 0.1
114 0.11
115 0.15
116 0.16
117 0.2
118 0.23
119 0.22
120 0.2
121 0.2
122 0.19
123 0.15
124 0.13
125 0.09
126 0.05
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.04
143 0.05
144 0.06
145 0.06
146 0.08
147 0.08
148 0.09
149 0.14
150 0.17
151 0.16
152 0.18
153 0.18
154 0.18
155 0.18
156 0.18
157 0.15
158 0.15
159 0.16
160 0.17
161 0.2
162 0.2
163 0.21
164 0.23
165 0.22
166 0.22
167 0.29
168 0.3
169 0.33
170 0.37
171 0.44
172 0.51
173 0.58
174 0.57
175 0.57
176 0.63
177 0.68
178 0.72
179 0.73
180 0.72
181 0.74
182 0.8
183 0.83
184 0.83
185 0.82
186 0.79
187 0.8
188 0.8
189 0.82
190 0.8
191 0.74
192 0.71
193 0.7
194 0.68
195 0.61
196 0.53
197 0.49
198 0.45
199 0.44
200 0.45
201 0.41