Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D6RLZ6

Protein Details
Accession D6RLZ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-69RCFGSRRSSRRTGRTKFRRFGGBasic
NLS Segment(s)
PositionSequence
53-74RRSSRRTGRTKFRRFGGSRRRG
Subcellular Location(s) plas 15, mito 6, extr 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cci:CC1G_14324  -  
Amino Acid Sequences MGSVFSAIGRGINSIISAIANVFMTIVSAITYVIVTIFDVITDILCCRCFGSRRSSRRTGRTKFRRFGGSRRRGATY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.05
6 0.06
7 0.05
8 0.05
9 0.05
10 0.04
11 0.04
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.05
32 0.05
33 0.06
34 0.06
35 0.1
36 0.12
37 0.15
38 0.25
39 0.34
40 0.42
41 0.5
42 0.59
43 0.64
44 0.71
45 0.79
46 0.77
47 0.79
48 0.82
49 0.84
50 0.81
51 0.79
52 0.8
53 0.74
54 0.76
55 0.76
56 0.75
57 0.73