Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319BTD0

Protein Details
Accession A0A319BTD0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100FREGKGSHRVQPPRRVKAYKBasic
NLS Segment(s)
Subcellular Location(s) extr 21, plas 3, vacu 2
Family & Domain DBs
Amino Acid Sequences MQLLPGILILPLLALQATAWSLTIYFTDGGHIASTGRLNSGCKAYDLPVHNRQVNRAVFSESTFADTFELFSDKDCRNRVFREGKGSHRVQPPRRVKAYKVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.05
5 0.04
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.07
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.06
20 0.07
21 0.08
22 0.07
23 0.08
24 0.08
25 0.09
26 0.1
27 0.12
28 0.12
29 0.12
30 0.13
31 0.13
32 0.17
33 0.2
34 0.25
35 0.29
36 0.32
37 0.35
38 0.34
39 0.34
40 0.36
41 0.34
42 0.3
43 0.24
44 0.23
45 0.2
46 0.21
47 0.21
48 0.14
49 0.17
50 0.14
51 0.13
52 0.12
53 0.11
54 0.11
55 0.1
56 0.11
57 0.07
58 0.09
59 0.14
60 0.16
61 0.22
62 0.25
63 0.28
64 0.32
65 0.35
66 0.43
67 0.45
68 0.47
69 0.52
70 0.52
71 0.56
72 0.6
73 0.6
74 0.59
75 0.6
76 0.67
77 0.64
78 0.7
79 0.73
80 0.75
81 0.8
82 0.78