Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8P8Q5

Protein Details
Accession A8P8Q5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-75IWIMWKGWPCRRKKPSKGNSEAEKGHydrophilic
108-135RELQRAREKERRRSERRSRKGKERDVPVBasic
NLS Segment(s)
PositionSequence
104-131SRRRRELQRAREKERRRSERRSRKGKER
Subcellular Location(s) extr 10, nucl 5, golg 3, vacu 3, mito_nucl 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cci:CC1G_10608  -  
Amino Acid Sequences MSTSFDPPPSSTSLLLWESASLAALKAKQHRKWVLPAVFITAAIILVLATIWIMWKGWPCRRKKPSKGNSEAEKGGVGGGWGDEAPRPVDIEALRDGGERVDESRRRRELQRAREKERRRSERRSRKGKERDVPVEKEYELRRKDGDVLDQSEPETEIDPFKSRSDVRVNEGEEGKAGERGDRNLGFESMSNGSRSRRPSLSASRSSSPDGRSGGSAAHGDTQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.17
5 0.15
6 0.14
7 0.13
8 0.09
9 0.08
10 0.09
11 0.12
12 0.16
13 0.25
14 0.34
15 0.38
16 0.48
17 0.54
18 0.57
19 0.63
20 0.68
21 0.63
22 0.58
23 0.54
24 0.49
25 0.43
26 0.37
27 0.29
28 0.19
29 0.14
30 0.1
31 0.09
32 0.03
33 0.03
34 0.03
35 0.02
36 0.02
37 0.02
38 0.03
39 0.03
40 0.03
41 0.05
42 0.11
43 0.18
44 0.26
45 0.34
46 0.4
47 0.51
48 0.61
49 0.71
50 0.76
51 0.81
52 0.83
53 0.87
54 0.88
55 0.86
56 0.82
57 0.76
58 0.66
59 0.56
60 0.46
61 0.35
62 0.26
63 0.17
64 0.1
65 0.05
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.07
75 0.06
76 0.09
77 0.09
78 0.11
79 0.11
80 0.11
81 0.11
82 0.11
83 0.11
84 0.08
85 0.09
86 0.07
87 0.07
88 0.13
89 0.18
90 0.22
91 0.3
92 0.34
93 0.37
94 0.4
95 0.48
96 0.51
97 0.57
98 0.64
99 0.64
100 0.68
101 0.74
102 0.78
103 0.77
104 0.79
105 0.78
106 0.75
107 0.77
108 0.81
109 0.83
110 0.87
111 0.88
112 0.84
113 0.84
114 0.87
115 0.86
116 0.82
117 0.79
118 0.78
119 0.74
120 0.71
121 0.61
122 0.53
123 0.44
124 0.41
125 0.37
126 0.35
127 0.3
128 0.28
129 0.28
130 0.27
131 0.31
132 0.27
133 0.3
134 0.26
135 0.29
136 0.28
137 0.27
138 0.26
139 0.23
140 0.21
141 0.16
142 0.13
143 0.09
144 0.09
145 0.11
146 0.13
147 0.14
148 0.15
149 0.18
150 0.18
151 0.23
152 0.3
153 0.31
154 0.33
155 0.38
156 0.39
157 0.39
158 0.39
159 0.34
160 0.26
161 0.25
162 0.2
163 0.16
164 0.15
165 0.15
166 0.15
167 0.18
168 0.23
169 0.23
170 0.24
171 0.24
172 0.24
173 0.21
174 0.2
175 0.21
176 0.18
177 0.18
178 0.18
179 0.18
180 0.2
181 0.25
182 0.29
183 0.32
184 0.31
185 0.34
186 0.41
187 0.49
188 0.55
189 0.58
190 0.6
191 0.58
192 0.58
193 0.59
194 0.56
195 0.47
196 0.44
197 0.37
198 0.33
199 0.3
200 0.28
201 0.24
202 0.22
203 0.2
204 0.16
205 0.21