Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319BSA2

Protein Details
Accession A0A319BSA2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-33FRTIRGRHSDNPRSKRQQRLRRRLRLMYGAHydrophilic
NLS Segment(s)
PositionSequence
16-26RSKRQQRLRRR
Subcellular Location(s) nucl 15, mito_nucl 12.333, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MVIFRTIRGRHSDNPRSKRQQRLRRRLRLMYGAFEYCYECDADISLLIRLKDTGQIYIFNSDSQWQPPKEQLVCIETNKLQASYYPKPKQVTREELAPKYRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.8
4 0.82
5 0.84
6 0.84
7 0.85
8 0.85
9 0.89
10 0.9
11 0.9
12 0.9
13 0.86
14 0.81
15 0.79
16 0.7
17 0.63
18 0.56
19 0.46
20 0.38
21 0.32
22 0.27
23 0.17
24 0.16
25 0.11
26 0.08
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.11
39 0.11
40 0.12
41 0.11
42 0.12
43 0.13
44 0.15
45 0.15
46 0.11
47 0.11
48 0.11
49 0.12
50 0.14
51 0.19
52 0.18
53 0.19
54 0.22
55 0.28
56 0.28
57 0.28
58 0.27
59 0.27
60 0.29
61 0.29
62 0.3
63 0.24
64 0.27
65 0.27
66 0.24
67 0.19
68 0.2
69 0.27
70 0.32
71 0.41
72 0.43
73 0.48
74 0.53
75 0.57
76 0.62
77 0.64
78 0.63
79 0.57
80 0.6
81 0.63
82 0.65