Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319BQ99

Protein Details
Accession A0A319BQ99    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26DRNTQEQIRKRRHNLFRRIKEFRDRYBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, mito_nucl 12.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences DRNTQEQIRKRRHNLFRRIKEFRDRYDIETWCTMRMPSGRIYVFNTNPNEPSPLTEEVVSSMMIAATKNYSSSLVGPSIDNHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.88
5 0.87
6 0.82
7 0.82
8 0.77
9 0.71
10 0.69
11 0.6
12 0.56
13 0.56
14 0.51
15 0.43
16 0.43
17 0.38
18 0.3
19 0.28
20 0.23
21 0.18
22 0.18
23 0.17
24 0.15
25 0.19
26 0.18
27 0.19
28 0.22
29 0.24
30 0.24
31 0.28
32 0.28
33 0.25
34 0.25
35 0.25
36 0.24
37 0.2
38 0.2
39 0.18
40 0.18
41 0.18
42 0.17
43 0.16
44 0.15
45 0.16
46 0.14
47 0.09
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.08
56 0.09
57 0.1
58 0.11
59 0.13
60 0.15
61 0.15
62 0.16
63 0.16