Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319C0K7

Protein Details
Accession A0A319C0K7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-83WCDDPRPTWKKSKKKTKRSTVEVSTGTHydrophilic
NLS Segment(s)
PositionSequence
65-74WKKSKKKTKR
Subcellular Location(s) plas 13, extr 5, E.R. 3, mito 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MREPSRVASGWRSGGPLFHVFLLFFLFAYVSLPHEPVYFPPLCISLSTCFQVSLFFWCDDPRPTWKKSKKKTKRSTVEVSTGTTFYLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.23
4 0.19
5 0.17
6 0.16
7 0.14
8 0.14
9 0.15
10 0.1
11 0.08
12 0.07
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.09
24 0.14
25 0.12
26 0.12
27 0.12
28 0.12
29 0.12
30 0.12
31 0.13
32 0.1
33 0.11
34 0.12
35 0.11
36 0.11
37 0.1
38 0.11
39 0.1
40 0.11
41 0.12
42 0.12
43 0.12
44 0.13
45 0.15
46 0.17
47 0.19
48 0.24
49 0.27
50 0.31
51 0.41
52 0.5
53 0.59
54 0.67
55 0.76
56 0.79
57 0.85
58 0.92
59 0.92
60 0.93
61 0.91
62 0.9
63 0.85
64 0.82
65 0.73
66 0.66
67 0.57
68 0.47