Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319C8Q0

Protein Details
Accession A0A319C8Q0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-39AASSRFRKSLLRPHHRRRRLGPAQPHydrophilic
NLS Segment(s)
PositionSequence
19-34RFRKSLLRPHHRRRRL
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007867  GMC_OxRtase_C  
Gene Ontology GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
Pfam View protein in Pfam  
PF05199  GMC_oxred_C  
Amino Acid Sequences MDPAKERNKHPPYIAASSRFRKSLLRPHHRRRRLGPAQPSIVPSSRGTITLASTDSAAAPLIDPNYYATEVDRVTLRAGNGQVNRLMLDTPQGKEMVTAEVDEAFRKGGMTFYHPAGSAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.56
3 0.57
4 0.58
5 0.58
6 0.51
7 0.46
8 0.42
9 0.43
10 0.47
11 0.5
12 0.55
13 0.62
14 0.72
15 0.82
16 0.85
17 0.86
18 0.83
19 0.83
20 0.81
21 0.8
22 0.78
23 0.74
24 0.69
25 0.63
26 0.59
27 0.5
28 0.42
29 0.35
30 0.26
31 0.21
32 0.18
33 0.17
34 0.16
35 0.13
36 0.13
37 0.11
38 0.11
39 0.09
40 0.08
41 0.08
42 0.07
43 0.06
44 0.06
45 0.04
46 0.04
47 0.04
48 0.05
49 0.04
50 0.05
51 0.06
52 0.07
53 0.08
54 0.07
55 0.07
56 0.09
57 0.09
58 0.1
59 0.09
60 0.08
61 0.09
62 0.11
63 0.11
64 0.11
65 0.13
66 0.17
67 0.18
68 0.19
69 0.19
70 0.18
71 0.18
72 0.16
73 0.15
74 0.09
75 0.14
76 0.16
77 0.15
78 0.16
79 0.16
80 0.16
81 0.16
82 0.17
83 0.14
84 0.11
85 0.11
86 0.1
87 0.12
88 0.12
89 0.12
90 0.12
91 0.1
92 0.09
93 0.1
94 0.09
95 0.1
96 0.12
97 0.17
98 0.2
99 0.22
100 0.24