Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319C780

Protein Details
Accession A0A319C780    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
119-140EEYSPVPKRRRSRGKQSSTAGSHydrophilic
NLS Segment(s)
PositionSequence
126-133KRRRSRGK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012808  CHP02453  
Pfam View protein in Pfam  
PF09365  DUF2461  
Amino Acid Sequences MPRRSSRPVPAAAAAPEAAPKRRVSARLSEASRTEPKRQKYDTTPAQKPIKSTTKTSKYFQEEPSEDPELDSKEAAAPKIPDYEDTDTSVPTSSDSGSDFAEEASPSAPSDEEHESEEEEYSPVPKRRRSRGKQSSTAGSRRHGSNSAEEDTTVSLAGKELWREGVKTGLGPGKEVFIKKPKARDPGAVAYKDNVLHPNTVLFLQDLAKNNDRQWLKAHDADYRAAKKDWETFVETLTEQIIDQDGTIPELPVKDLVFRIHRDIRFSKNPLPYKTHFSAAWSRTGKKGPYAAYYVHCQPGASFVGSGLWAPEADGLARLRQDINHRSHRLKKVLRAPKMRQEIFKSIPDDDEKAVEAFVSHNKESALKTKPKGYDADNENIQLLRLRSFTIGRSLSDEELLSPNAQDRIAALVEIMEPFVTYLNSVVMPDAVQEDVDTDSEASED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.26
3 0.25
4 0.25
5 0.25
6 0.25
7 0.24
8 0.28
9 0.34
10 0.39
11 0.39
12 0.45
13 0.5
14 0.56
15 0.59
16 0.58
17 0.53
18 0.55
19 0.59
20 0.55
21 0.57
22 0.56
23 0.6
24 0.65
25 0.68
26 0.69
27 0.69
28 0.74
29 0.74
30 0.75
31 0.74
32 0.74
33 0.77
34 0.71
35 0.65
36 0.64
37 0.63
38 0.57
39 0.58
40 0.6
41 0.62
42 0.65
43 0.66
44 0.66
45 0.64
46 0.67
47 0.64
48 0.63
49 0.56
50 0.54
51 0.56
52 0.51
53 0.42
54 0.37
55 0.35
56 0.27
57 0.26
58 0.22
59 0.16
60 0.18
61 0.2
62 0.19
63 0.2
64 0.19
65 0.19
66 0.24
67 0.24
68 0.22
69 0.26
70 0.3
71 0.28
72 0.3
73 0.29
74 0.24
75 0.25
76 0.23
77 0.17
78 0.13
79 0.12
80 0.09
81 0.1
82 0.11
83 0.11
84 0.11
85 0.11
86 0.11
87 0.1
88 0.11
89 0.09
90 0.09
91 0.08
92 0.08
93 0.07
94 0.08
95 0.08
96 0.06
97 0.11
98 0.13
99 0.14
100 0.16
101 0.16
102 0.17
103 0.17
104 0.18
105 0.14
106 0.11
107 0.1
108 0.11
109 0.17
110 0.22
111 0.27
112 0.33
113 0.41
114 0.51
115 0.62
116 0.69
117 0.74
118 0.79
119 0.83
120 0.84
121 0.81
122 0.8
123 0.75
124 0.74
125 0.65
126 0.57
127 0.52
128 0.45
129 0.44
130 0.39
131 0.34
132 0.33
133 0.35
134 0.34
135 0.3
136 0.28
137 0.25
138 0.21
139 0.19
140 0.13
141 0.08
142 0.06
143 0.06
144 0.07
145 0.08
146 0.08
147 0.08
148 0.11
149 0.12
150 0.12
151 0.13
152 0.14
153 0.13
154 0.13
155 0.15
156 0.15
157 0.14
158 0.15
159 0.14
160 0.14
161 0.16
162 0.17
163 0.18
164 0.23
165 0.3
166 0.32
167 0.4
168 0.44
169 0.49
170 0.5
171 0.51
172 0.49
173 0.5
174 0.53
175 0.46
176 0.4
177 0.34
178 0.33
179 0.3
180 0.25
181 0.19
182 0.14
183 0.13
184 0.13
185 0.13
186 0.11
187 0.11
188 0.1
189 0.07
190 0.07
191 0.08
192 0.11
193 0.13
194 0.17
195 0.19
196 0.2
197 0.21
198 0.27
199 0.26
200 0.23
201 0.24
202 0.25
203 0.26
204 0.28
205 0.29
206 0.26
207 0.27
208 0.28
209 0.3
210 0.27
211 0.26
212 0.23
213 0.22
214 0.2
215 0.24
216 0.24
217 0.22
218 0.23
219 0.21
220 0.21
221 0.22
222 0.2
223 0.15
224 0.13
225 0.1
226 0.06
227 0.06
228 0.06
229 0.04
230 0.04
231 0.06
232 0.06
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.07
241 0.07
242 0.08
243 0.11
244 0.14
245 0.15
246 0.21
247 0.27
248 0.27
249 0.32
250 0.35
251 0.39
252 0.43
253 0.46
254 0.48
255 0.5
256 0.55
257 0.53
258 0.57
259 0.52
260 0.53
261 0.5
262 0.45
263 0.37
264 0.35
265 0.39
266 0.34
267 0.4
268 0.35
269 0.35
270 0.36
271 0.4
272 0.37
273 0.32
274 0.35
275 0.29
276 0.29
277 0.3
278 0.29
279 0.27
280 0.3
281 0.29
282 0.26
283 0.24
284 0.2
285 0.18
286 0.19
287 0.18
288 0.15
289 0.12
290 0.1
291 0.11
292 0.11
293 0.11
294 0.07
295 0.06
296 0.05
297 0.05
298 0.06
299 0.05
300 0.05
301 0.08
302 0.08
303 0.09
304 0.1
305 0.11
306 0.11
307 0.13
308 0.21
309 0.27
310 0.34
311 0.43
312 0.48
313 0.53
314 0.62
315 0.67
316 0.69
317 0.68
318 0.69
319 0.69
320 0.74
321 0.77
322 0.78
323 0.76
324 0.76
325 0.8
326 0.75
327 0.7
328 0.68
329 0.66
330 0.6
331 0.59
332 0.52
333 0.43
334 0.43
335 0.4
336 0.35
337 0.28
338 0.25
339 0.21
340 0.18
341 0.17
342 0.13
343 0.1
344 0.1
345 0.15
346 0.19
347 0.18
348 0.19
349 0.2
350 0.23
351 0.25
352 0.3
353 0.33
354 0.35
355 0.39
356 0.46
357 0.49
358 0.5
359 0.51
360 0.48
361 0.49
362 0.47
363 0.5
364 0.44
365 0.41
366 0.39
367 0.35
368 0.31
369 0.26
370 0.21
371 0.17
372 0.15
373 0.16
374 0.17
375 0.19
376 0.2
377 0.25
378 0.25
379 0.24
380 0.28
381 0.3
382 0.28
383 0.28
384 0.26
385 0.2
386 0.21
387 0.21
388 0.17
389 0.14
390 0.16
391 0.16
392 0.16
393 0.14
394 0.12
395 0.14
396 0.14
397 0.13
398 0.11
399 0.1
400 0.11
401 0.11
402 0.11
403 0.07
404 0.06
405 0.06
406 0.08
407 0.07
408 0.06
409 0.07
410 0.08
411 0.09
412 0.09
413 0.09
414 0.09
415 0.09
416 0.09
417 0.1
418 0.09
419 0.08
420 0.08
421 0.09
422 0.09
423 0.1
424 0.1
425 0.09