Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CXZ1

Protein Details
Accession A0A319CXZ1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQRHNRRRTRPRSRNRSSSITNHydrophilic
NLS Segment(s)
PositionSequence
7-14RRRTRPRS
Subcellular Location(s) mito 12.5, mito_nucl 11.333, nucl 9, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRPRSRNRSSSITNNNNNNHPNLIEAFSRPLNPVLPSAAFDYHETPAPTWHYGDLTWQTRHRTMRLETPNIEAEQCRLFGGEPGDDVGLCYRMMEYFGGLDYIDCPQSLNALPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.88
4 0.85
5 0.8
6 0.79
7 0.78
8 0.77
9 0.75
10 0.72
11 0.69
12 0.67
13 0.63
14 0.55
15 0.46
16 0.36
17 0.3
18 0.24
19 0.23
20 0.17
21 0.16
22 0.17
23 0.17
24 0.17
25 0.17
26 0.16
27 0.15
28 0.15
29 0.15
30 0.13
31 0.13
32 0.13
33 0.14
34 0.13
35 0.13
36 0.13
37 0.14
38 0.13
39 0.15
40 0.15
41 0.13
42 0.14
43 0.16
44 0.15
45 0.13
46 0.13
47 0.11
48 0.11
49 0.13
50 0.16
51 0.17
52 0.19
53 0.21
54 0.24
55 0.28
56 0.3
57 0.3
58 0.3
59 0.28
60 0.35
61 0.39
62 0.41
63 0.38
64 0.39
65 0.39
66 0.35
67 0.33
68 0.24
69 0.19
70 0.16
71 0.15
72 0.11
73 0.09
74 0.09
75 0.11
76 0.12
77 0.11
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.07
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.12