Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319C3Z5

Protein Details
Accession A0A319C3Z5   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
95-116RNTSSSSGRKGKKSKPPLHSAGHydrophilic
526-546GKQPETARKERQPTWRRVQDDHydrophilic
NLS Segment(s)
PositionSequence
102-113GRKGKKSKPPLH
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, cyto 6, cyto_mito 4.833, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039128  TRIP4-like  
IPR009349  Znf_C2HC5  
Gene Ontology GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06221  zf-C2HC5  
Amino Acid Sequences MSNTGLVAWGVPRLAELLPLDQESLTQIIDYAASLSKEEGADHLKNLLGDSPAAFEFIAAFSSRRSAPAPQRSAASSPAPTLAPAPSSASSAPPRNTSSSSGRKGKKSKPPLHSAGPVRRPENFGDVTGGYRKEDQNEDYMPVSMSGRGQPDAKPPLGLRNLPVTSSQGSSATSSRNQSPAPPRPKSTTSSNSNNNKAPPSAAGPVISDLLPNVKSKAAKSTGRGGGGGGGGGGNAGGGSSSSAKGGGALTTTNITDLTAAIAALEVSTNPTLGTGARKCTCYASIHPLFDPAPNCLNCGKIVCALEGLQPCSFCGTPLLSSDEVQSMIRELRAERGQEKMRAHNEGVQHRDGGPGLGPGITPGSSNNNRLDAARAHRDKLLQFQAQNAKRTRVVDEAADFETPNVASTLWMTPAQRALALKKQQRIMREMEEKARPEWEKKKTIMSLDIKGGRVTRVYQSAAEASGSSKAAAAEEEEAKVEDGDDIAQLGDEADRGSSGGGHAFSNNPLLAAGGLLRPVWKTADGKQPETARKERQPTWRRVQDDNDDNEQWILDGGAHGYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.14
5 0.16
6 0.17
7 0.18
8 0.16
9 0.16
10 0.15
11 0.14
12 0.11
13 0.09
14 0.09
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.11
23 0.13
24 0.13
25 0.14
26 0.15
27 0.19
28 0.2
29 0.2
30 0.22
31 0.2
32 0.2
33 0.21
34 0.2
35 0.14
36 0.14
37 0.13
38 0.14
39 0.13
40 0.14
41 0.13
42 0.1
43 0.1
44 0.09
45 0.1
46 0.08
47 0.09
48 0.08
49 0.12
50 0.13
51 0.15
52 0.17
53 0.24
54 0.33
55 0.43
56 0.48
57 0.46
58 0.49
59 0.49
60 0.49
61 0.45
62 0.39
63 0.3
64 0.26
65 0.26
66 0.23
67 0.21
68 0.2
69 0.17
70 0.14
71 0.13
72 0.16
73 0.14
74 0.17
75 0.17
76 0.2
77 0.25
78 0.3
79 0.32
80 0.32
81 0.35
82 0.37
83 0.39
84 0.4
85 0.43
86 0.46
87 0.52
88 0.57
89 0.6
90 0.65
91 0.71
92 0.76
93 0.77
94 0.79
95 0.8
96 0.79
97 0.82
98 0.79
99 0.77
100 0.76
101 0.74
102 0.73
103 0.71
104 0.68
105 0.61
106 0.58
107 0.54
108 0.49
109 0.46
110 0.38
111 0.3
112 0.27
113 0.26
114 0.25
115 0.26
116 0.24
117 0.19
118 0.21
119 0.22
120 0.23
121 0.26
122 0.25
123 0.27
124 0.27
125 0.28
126 0.25
127 0.24
128 0.21
129 0.18
130 0.17
131 0.12
132 0.12
133 0.13
134 0.14
135 0.15
136 0.16
137 0.17
138 0.24
139 0.29
140 0.28
141 0.27
142 0.26
143 0.32
144 0.35
145 0.34
146 0.28
147 0.31
148 0.31
149 0.29
150 0.3
151 0.25
152 0.22
153 0.22
154 0.2
155 0.13
156 0.14
157 0.15
158 0.15
159 0.16
160 0.17
161 0.19
162 0.21
163 0.23
164 0.23
165 0.28
166 0.36
167 0.42
168 0.48
169 0.5
170 0.51
171 0.54
172 0.58
173 0.55
174 0.54
175 0.52
176 0.5
177 0.54
178 0.6
179 0.61
180 0.63
181 0.62
182 0.56
183 0.49
184 0.43
185 0.36
186 0.28
187 0.24
188 0.21
189 0.19
190 0.17
191 0.15
192 0.15
193 0.15
194 0.13
195 0.09
196 0.07
197 0.09
198 0.09
199 0.1
200 0.1
201 0.12
202 0.13
203 0.14
204 0.21
205 0.24
206 0.26
207 0.28
208 0.36
209 0.37
210 0.36
211 0.35
212 0.29
213 0.24
214 0.21
215 0.17
216 0.09
217 0.05
218 0.04
219 0.04
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.03
227 0.04
228 0.04
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.04
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.02
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.05
260 0.05
261 0.1
262 0.1
263 0.15
264 0.17
265 0.18
266 0.18
267 0.19
268 0.21
269 0.19
270 0.21
271 0.25
272 0.27
273 0.27
274 0.26
275 0.26
276 0.25
277 0.24
278 0.22
279 0.16
280 0.17
281 0.16
282 0.18
283 0.17
284 0.17
285 0.15
286 0.15
287 0.14
288 0.12
289 0.13
290 0.11
291 0.11
292 0.11
293 0.14
294 0.15
295 0.16
296 0.13
297 0.12
298 0.12
299 0.14
300 0.13
301 0.1
302 0.1
303 0.09
304 0.09
305 0.11
306 0.14
307 0.12
308 0.13
309 0.14
310 0.13
311 0.13
312 0.12
313 0.1
314 0.08
315 0.08
316 0.08
317 0.08
318 0.08
319 0.12
320 0.15
321 0.17
322 0.17
323 0.23
324 0.26
325 0.31
326 0.33
327 0.35
328 0.35
329 0.37
330 0.37
331 0.35
332 0.37
333 0.37
334 0.39
335 0.32
336 0.3
337 0.27
338 0.27
339 0.23
340 0.18
341 0.12
342 0.08
343 0.07
344 0.07
345 0.06
346 0.05
347 0.06
348 0.06
349 0.06
350 0.06
351 0.14
352 0.17
353 0.2
354 0.21
355 0.23
356 0.23
357 0.23
358 0.25
359 0.22
360 0.25
361 0.31
362 0.32
363 0.32
364 0.33
365 0.36
366 0.34
367 0.37
368 0.38
369 0.33
370 0.31
371 0.36
372 0.44
373 0.45
374 0.51
375 0.46
376 0.43
377 0.42
378 0.43
379 0.4
380 0.34
381 0.31
382 0.26
383 0.25
384 0.25
385 0.23
386 0.21
387 0.18
388 0.14
389 0.14
390 0.11
391 0.1
392 0.08
393 0.06
394 0.06
395 0.08
396 0.09
397 0.1
398 0.12
399 0.12
400 0.13
401 0.15
402 0.15
403 0.16
404 0.16
405 0.19
406 0.25
407 0.33
408 0.38
409 0.41
410 0.47
411 0.48
412 0.51
413 0.51
414 0.48
415 0.47
416 0.49
417 0.47
418 0.48
419 0.51
420 0.49
421 0.45
422 0.47
423 0.41
424 0.43
425 0.48
426 0.49
427 0.51
428 0.51
429 0.58
430 0.55
431 0.56
432 0.57
433 0.53
434 0.49
435 0.49
436 0.5
437 0.44
438 0.41
439 0.38
440 0.3
441 0.27
442 0.25
443 0.22
444 0.23
445 0.23
446 0.22
447 0.24
448 0.24
449 0.22
450 0.2
451 0.16
452 0.13
453 0.13
454 0.13
455 0.11
456 0.1
457 0.1
458 0.1
459 0.1
460 0.1
461 0.11
462 0.12
463 0.13
464 0.13
465 0.13
466 0.13
467 0.13
468 0.11
469 0.08
470 0.07
471 0.07
472 0.06
473 0.06
474 0.05
475 0.05
476 0.05
477 0.05
478 0.05
479 0.05
480 0.05
481 0.05
482 0.05
483 0.05
484 0.05
485 0.05
486 0.06
487 0.08
488 0.09
489 0.1
490 0.11
491 0.12
492 0.13
493 0.17
494 0.16
495 0.13
496 0.12
497 0.12
498 0.11
499 0.1
500 0.1
501 0.07
502 0.08
503 0.08
504 0.09
505 0.09
506 0.11
507 0.13
508 0.16
509 0.18
510 0.25
511 0.35
512 0.39
513 0.42
514 0.48
515 0.54
516 0.58
517 0.62
518 0.63
519 0.63
520 0.66
521 0.71
522 0.72
523 0.75
524 0.77
525 0.79
526 0.82
527 0.82
528 0.78
529 0.76
530 0.76
531 0.76
532 0.75
533 0.71
534 0.67
535 0.59
536 0.55
537 0.49
538 0.41
539 0.3
540 0.21
541 0.15
542 0.08
543 0.07