Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319C2U0

Protein Details
Accession A0A319C2U0   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-54SERLTKTPCKTPRESKQKRRTPNGRSNAYHydrophilic
100-121KVATRACARHPRKFKRAWSSMLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, extr 5, plas 4, golg 4, E.R. 3, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MRWRHVCVCVCVCVCVWQFVCVPLQSERLTKTPCKTPRESKQKRRTPNGRSNAYIKNPTRYEEADQAEEEAVKETILRNVDHNSRTVMKQGGKCFTHGGKVATRACARHPRKFKRAWSSMLEEGKDQGVRESI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.28
4 0.25
5 0.25
6 0.25
7 0.27
8 0.21
9 0.22
10 0.19
11 0.22
12 0.21
13 0.23
14 0.25
15 0.27
16 0.31
17 0.33
18 0.35
19 0.41
20 0.47
21 0.51
22 0.56
23 0.6
24 0.67
25 0.74
26 0.8
27 0.81
28 0.84
29 0.87
30 0.89
31 0.89
32 0.88
33 0.87
34 0.86
35 0.84
36 0.78
37 0.72
38 0.67
39 0.63
40 0.57
41 0.56
42 0.47
43 0.45
44 0.41
45 0.4
46 0.38
47 0.34
48 0.33
49 0.3
50 0.31
51 0.25
52 0.24
53 0.22
54 0.19
55 0.17
56 0.14
57 0.08
58 0.07
59 0.05
60 0.05
61 0.05
62 0.08
63 0.1
64 0.1
65 0.11
66 0.14
67 0.19
68 0.2
69 0.2
70 0.2
71 0.21
72 0.21
73 0.23
74 0.24
75 0.25
76 0.29
77 0.33
78 0.37
79 0.35
80 0.36
81 0.37
82 0.33
83 0.33
84 0.3
85 0.29
86 0.25
87 0.31
88 0.32
89 0.34
90 0.35
91 0.32
92 0.36
93 0.44
94 0.47
95 0.5
96 0.59
97 0.63
98 0.71
99 0.78
100 0.81
101 0.81
102 0.81
103 0.77
104 0.73
105 0.7
106 0.69
107 0.65
108 0.57
109 0.47
110 0.41
111 0.39
112 0.34
113 0.27