Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319D5W5

Protein Details
Accession A0A319D5W5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-23PQDWYKSEKNYKKKLEFPVRYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, E.R. 5, cyto 3.5, cyto_nucl 3, golg 3, plas 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIPQDWYKSEKNYKKKLEFPVRYVQMLIDMENIPLLDSILAAVFCWILLAGYLVFPGTFILL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.81
4 0.82
5 0.78
6 0.73
7 0.73
8 0.66
9 0.59
10 0.51
11 0.4
12 0.32
13 0.27
14 0.22
15 0.14
16 0.11
17 0.1
18 0.1
19 0.1
20 0.07
21 0.06
22 0.06
23 0.03
24 0.03
25 0.03
26 0.04
27 0.04
28 0.03
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05