Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CGU4

Protein Details
Accession A0A319CGU4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-69AANLRDRWRRKATRGRKIHLCQCWFHydrophilic
NLS Segment(s)
PositionSequence
52-60WRRKATRGR
Subcellular Location(s) mito 10, extr 8, plas 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MPLLPPSLCLSLSLSVSLSIHQAIHRSIYLLLSTLPTHSPGRTMAANLRDRWRRKATRGRKIHLCQCWFSGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.1
6 0.09
7 0.09
8 0.09
9 0.1
10 0.1
11 0.11
12 0.11
13 0.11
14 0.11
15 0.1
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.09
24 0.1
25 0.1
26 0.11
27 0.1
28 0.13
29 0.12
30 0.13
31 0.15
32 0.22
33 0.26
34 0.28
35 0.35
36 0.41
37 0.44
38 0.51
39 0.56
40 0.56
41 0.62
42 0.7
43 0.73
44 0.76
45 0.82
46 0.82
47 0.83
48 0.84
49 0.84
50 0.82
51 0.77
52 0.69