Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319C5Y9

Protein Details
Accession A0A319C5Y9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-104SVLTRFQRLRKQSQEKRRADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR023278  Ethylene_insens-like_DNA-bd  
IPR047092  YDR124W-like_helical  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF11001  DUF2841  
Amino Acid Sequences MAPGKDSGFHNKIFSNLHASSLTRLLLMLAENLYPEKRLRFSSTEQKPKWWPAEITYIHPTKLKKRDRLSVAIKILSSFEPVDDSVLTRFQRLRKQSQEKRRADMDEQESSPSQSSAYYTSAGESRFDSGNKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.27
4 0.27
5 0.26
6 0.26
7 0.25
8 0.24
9 0.22
10 0.15
11 0.14
12 0.11
13 0.1
14 0.1
15 0.09
16 0.07
17 0.07
18 0.07
19 0.09
20 0.09
21 0.1
22 0.11
23 0.12
24 0.14
25 0.17
26 0.22
27 0.25
28 0.31
29 0.4
30 0.48
31 0.56
32 0.54
33 0.57
34 0.57
35 0.58
36 0.56
37 0.49
38 0.4
39 0.32
40 0.4
41 0.36
42 0.36
43 0.35
44 0.33
45 0.3
46 0.32
47 0.31
48 0.3
49 0.38
50 0.41
51 0.45
52 0.49
53 0.56
54 0.57
55 0.63
56 0.6
57 0.58
58 0.52
59 0.45
60 0.4
61 0.32
62 0.29
63 0.21
64 0.18
65 0.1
66 0.08
67 0.08
68 0.08
69 0.09
70 0.08
71 0.08
72 0.08
73 0.12
74 0.12
75 0.13
76 0.16
77 0.2
78 0.28
79 0.33
80 0.41
81 0.48
82 0.59
83 0.67
84 0.75
85 0.81
86 0.78
87 0.77
88 0.74
89 0.68
90 0.6
91 0.59
92 0.54
93 0.49
94 0.45
95 0.43
96 0.38
97 0.35
98 0.32
99 0.23
100 0.18
101 0.12
102 0.13
103 0.13
104 0.14
105 0.14
106 0.13
107 0.15
108 0.17
109 0.18
110 0.17
111 0.16
112 0.17
113 0.18
114 0.2