Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CI93

Protein Details
Accession A0A319CI93   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-108KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MSVRSLLGASTGALRQLLPSLSRKPAGLLSRSFSQLAKLPFSNGLRLLRSGQQTGVASASLRQVEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.11
4 0.12
5 0.12
6 0.17
7 0.21
8 0.24
9 0.26
10 0.25
11 0.25
12 0.3
13 0.32
14 0.31
15 0.28
16 0.29
17 0.3
18 0.32
19 0.31
20 0.25
21 0.22
22 0.23
23 0.23
24 0.22
25 0.19
26 0.19
27 0.23
28 0.23
29 0.23
30 0.22
31 0.22
32 0.19
33 0.2
34 0.21
35 0.2
36 0.21
37 0.2
38 0.17
39 0.17
40 0.16
41 0.16
42 0.14
43 0.1
44 0.08
45 0.08
46 0.1
47 0.07
48 0.07
49 0.08
50 0.09
51 0.1
52 0.16
53 0.2
54 0.2
55 0.22
56 0.23
57 0.23
58 0.25
59 0.34
60 0.34
61 0.37
62 0.39
63 0.4
64 0.48
65 0.51
66 0.51
67 0.5
68 0.52
69 0.54
70 0.6
71 0.64
72 0.66
73 0.72
74 0.78
75 0.77
76 0.79
77 0.8
78 0.79
79 0.77
80 0.78
81 0.76
82 0.77
83 0.79
84 0.75
85 0.75
86 0.77
87 0.81
88 0.82