Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DNS9

Protein Details
Accession A0A319DNS9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-129LSGVCKTHQPPPKKREYRRKKGBasic
NLS Segment(s)
PositionSequence
118-129PPKKREYRRKKG
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSAFWRVPFTSSPDVSEYSRECDTFTSKPCRGPLPNPYQLPDRFTSPWVSYPPNSHDLTSPCLLVSSARLRPRGVTRPERGLLPWWTALVKRDLRSSQQAFGMRGFLLSGVCKTHQPPPKKREYRRKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.34
4 0.29
5 0.26
6 0.27
7 0.24
8 0.22
9 0.22
10 0.26
11 0.26
12 0.31
13 0.35
14 0.36
15 0.4
16 0.42
17 0.47
18 0.46
19 0.48
20 0.51
21 0.51
22 0.57
23 0.54
24 0.54
25 0.53
26 0.5
27 0.48
28 0.39
29 0.35
30 0.28
31 0.28
32 0.29
33 0.24
34 0.26
35 0.25
36 0.26
37 0.23
38 0.25
39 0.28
40 0.29
41 0.28
42 0.25
43 0.25
44 0.24
45 0.26
46 0.23
47 0.19
48 0.14
49 0.14
50 0.13
51 0.1
52 0.11
53 0.12
54 0.16
55 0.19
56 0.21
57 0.21
58 0.24
59 0.3
60 0.35
61 0.38
62 0.41
63 0.42
64 0.47
65 0.47
66 0.45
67 0.41
68 0.37
69 0.32
70 0.26
71 0.23
72 0.18
73 0.18
74 0.18
75 0.19
76 0.21
77 0.23
78 0.22
79 0.27
80 0.29
81 0.33
82 0.41
83 0.42
84 0.37
85 0.38
86 0.4
87 0.36
88 0.35
89 0.32
90 0.23
91 0.2
92 0.17
93 0.12
94 0.1
95 0.09
96 0.1
97 0.11
98 0.12
99 0.15
100 0.17
101 0.26
102 0.33
103 0.42
104 0.51
105 0.57
106 0.67
107 0.76
108 0.84
109 0.87