Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319D5Q9

Protein Details
Accession A0A319D5Q9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-34KLPKVPSSPEKVVRQKRDRRKKSLIHKAYEYHydrophilic
NLS Segment(s)
PositionSequence
15-25VVRQKRDRRKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences DNEKLPKVPSSPEKVVRQKRDRRKKSLIHKAYEYSKLCDADICLGIRIRESGQVTTFQSDSTGFWSGFSSHLETYYPRPVQKTDKDFDKTPAGESADEEDTIKTQEDKAMTKADKKSSIFDKHSAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.76
3 0.79
4 0.81
5 0.83
6 0.87
7 0.9
8 0.9
9 0.89
10 0.89
11 0.88
12 0.88
13 0.89
14 0.87
15 0.81
16 0.76
17 0.72
18 0.67
19 0.66
20 0.57
21 0.49
22 0.44
23 0.39
24 0.34
25 0.29
26 0.25
27 0.19
28 0.19
29 0.16
30 0.13
31 0.13
32 0.13
33 0.13
34 0.13
35 0.1
36 0.12
37 0.13
38 0.13
39 0.13
40 0.16
41 0.17
42 0.17
43 0.16
44 0.12
45 0.11
46 0.11
47 0.1
48 0.1
49 0.11
50 0.09
51 0.1
52 0.1
53 0.1
54 0.11
55 0.11
56 0.11
57 0.09
58 0.1
59 0.1
60 0.11
61 0.14
62 0.21
63 0.22
64 0.21
65 0.23
66 0.26
67 0.33
68 0.4
69 0.43
70 0.4
71 0.45
72 0.49
73 0.48
74 0.49
75 0.48
76 0.4
77 0.36
78 0.35
79 0.29
80 0.25
81 0.24
82 0.24
83 0.19
84 0.18
85 0.17
86 0.14
87 0.13
88 0.14
89 0.14
90 0.1
91 0.1
92 0.13
93 0.16
94 0.18
95 0.2
96 0.27
97 0.29
98 0.36
99 0.42
100 0.45
101 0.5
102 0.49
103 0.53
104 0.54
105 0.6
106 0.58