Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RK27

Protein Details
Accession D6RK27    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
115-135NHPFYAPSKKKNVVKRRGVRKBasic
NLS Segment(s)
PositionSequence
123-135KKKNVVKRRGVRK
Subcellular Location(s) E.R. 6, nucl 5, extr 5, cyto 4, mito_nucl 4, mito 3
Family & Domain DBs
KEGG cci:CC1G_13558  -  
Amino Acid Sequences MVALSKFYILSLIPILASLSAVAGHSPDALSPARLSRRNNLVDDYNHRRELLEDILYERDLLEDMLYERDLLEDMLYERDLLEDLLYERDHETKPKPFVKKPFGTKDAIAYIYANHPFYAPSKKKNVVKRRGVRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.08
16 0.08
17 0.09
18 0.1
19 0.15
20 0.21
21 0.27
22 0.3
23 0.34
24 0.42
25 0.45
26 0.46
27 0.43
28 0.41
29 0.4
30 0.45
31 0.47
32 0.44
33 0.4
34 0.39
35 0.35
36 0.32
37 0.31
38 0.26
39 0.19
40 0.14
41 0.14
42 0.15
43 0.15
44 0.14
45 0.11
46 0.08
47 0.06
48 0.06
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.04
71 0.05
72 0.07
73 0.07
74 0.07
75 0.08
76 0.11
77 0.12
78 0.16
79 0.2
80 0.25
81 0.33
82 0.4
83 0.46
84 0.5
85 0.59
86 0.65
87 0.69
88 0.71
89 0.72
90 0.69
91 0.66
92 0.6
93 0.54
94 0.48
95 0.41
96 0.32
97 0.23
98 0.2
99 0.22
100 0.24
101 0.2
102 0.16
103 0.16
104 0.16
105 0.2
106 0.29
107 0.3
108 0.35
109 0.43
110 0.52
111 0.59
112 0.69
113 0.76
114 0.76
115 0.81