Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319BSH8

Protein Details
Accession A0A319BSH8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-102IEERTRKQPSEPKKEPPHSRBasic
NLS Segment(s)
PositionSequence
94-98PKKEP
Subcellular Location(s) mito 14, nucl 4.5, cyto_nucl 4, cyto 2.5, plas 2, extr 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MFRLPKDIPRATLAGAVICITISGTLFGASQKSQHQLQQKVQEQKALEPTIDERINGLRGMRENLMAKKELVEKQLQNLEAKIEERTRKQPSEPKKEPPHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.15
4 0.11
5 0.09
6 0.08
7 0.05
8 0.05
9 0.04
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.08
16 0.08
17 0.1
18 0.12
19 0.15
20 0.16
21 0.21
22 0.29
23 0.33
24 0.39
25 0.46
26 0.51
27 0.56
28 0.55
29 0.54
30 0.46
31 0.43
32 0.42
33 0.33
34 0.26
35 0.18
36 0.19
37 0.2
38 0.19
39 0.17
40 0.12
41 0.12
42 0.13
43 0.13
44 0.12
45 0.09
46 0.1
47 0.12
48 0.12
49 0.14
50 0.16
51 0.19
52 0.21
53 0.2
54 0.19
55 0.19
56 0.24
57 0.24
58 0.24
59 0.28
60 0.26
61 0.31
62 0.35
63 0.35
64 0.3
65 0.28
66 0.26
67 0.22
68 0.22
69 0.21
70 0.23
71 0.27
72 0.31
73 0.39
74 0.45
75 0.47
76 0.54
77 0.6
78 0.64
79 0.69
80 0.71
81 0.73
82 0.76