Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CUJ6

Protein Details
Accession A0A319CUJ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-52HNGAAGPEKKRRRWRGRRSEAQERRCPGBasic
NLS Segment(s)
PositionSequence
30-43GPEKKRRRWRGRRS
Subcellular Location(s) cyto 22, mito 3
Family & Domain DBs
Amino Acid Sequences MGLKVGGWWVGPVVLVDTHEARRCHNGAAGPEKKRRRWRGRRSEAQERRCPGFYKTETVAAATASLPFGIILSRYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.11
5 0.15
6 0.2
7 0.2
8 0.21
9 0.26
10 0.27
11 0.26
12 0.26
13 0.25
14 0.24
15 0.33
16 0.38
17 0.38
18 0.46
19 0.51
20 0.56
21 0.63
22 0.69
23 0.71
24 0.76
25 0.81
26 0.84
27 0.88
28 0.91
29 0.89
30 0.9
31 0.88
32 0.85
33 0.81
34 0.74
35 0.68
36 0.6
37 0.54
38 0.45
39 0.45
40 0.38
41 0.37
42 0.35
43 0.35
44 0.32
45 0.31
46 0.29
47 0.2
48 0.18
49 0.13
50 0.11
51 0.08
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06