Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CUY6

Protein Details
Accession A0A319CUY6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-47LLSPFVFSVQKKKKKKKKKNKRKKKKGKKNGMQYPSQBasic
NLS Segment(s)
PositionSequence
21-40KKKKKKKKKNKRKKKKGKKN
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MHYYPNIGKSLLSPFVFSVQKKKKKKKKKNKRKKKKGKKNGMQYPSQQRKSSGVYDQKCFTKNAAKRRLGSVWPCVSVPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.29
4 0.28
5 0.33
6 0.38
7 0.48
8 0.57
9 0.68
10 0.73
11 0.81
12 0.92
13 0.92
14 0.94
15 0.95
16 0.96
17 0.97
18 0.98
19 0.98
20 0.98
21 0.98
22 0.98
23 0.97
24 0.97
25 0.95
26 0.94
27 0.92
28 0.85
29 0.78
30 0.73
31 0.73
32 0.71
33 0.66
34 0.57
35 0.49
36 0.48
37 0.47
38 0.44
39 0.41
40 0.41
41 0.4
42 0.43
43 0.44
44 0.45
45 0.43
46 0.4
47 0.35
48 0.36
49 0.38
50 0.45
51 0.52
52 0.54
53 0.55
54 0.6
55 0.62
56 0.6
57 0.59
58 0.57
59 0.52
60 0.48