Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319E7Y3

Protein Details
Accession A0A319E7Y3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-93SESGPTKKTKKSKSKSKGKSKSHTKSKSKSKSKSKKSKAKSSTSDSSHydrophilic
NLS Segment(s)
PositionSequence
52-86TKKTKKSKSKSKGKSKSHTKSKSKSKSKSKKSKAK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MLKGLRRQDIPRLSTLTQSSKSEKKEQSLWDIDDSDEGLSSEDSSESESGPTKKTKKSKSKSKGKSKSHTKSKSKSKSKSKKSKAKSSTSDSSDSESEGDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.44
4 0.39
5 0.39
6 0.41
7 0.41
8 0.45
9 0.5
10 0.49
11 0.47
12 0.5
13 0.5
14 0.52
15 0.5
16 0.47
17 0.4
18 0.37
19 0.32
20 0.26
21 0.23
22 0.15
23 0.1
24 0.08
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.07
35 0.09
36 0.1
37 0.12
38 0.17
39 0.2
40 0.26
41 0.35
42 0.44
43 0.53
44 0.61
45 0.7
46 0.76
47 0.83
48 0.87
49 0.9
50 0.9
51 0.89
52 0.9
53 0.9
54 0.89
55 0.89
56 0.89
57 0.87
58 0.86
59 0.88
60 0.89
61 0.88
62 0.88
63 0.88
64 0.89
65 0.91
66 0.92
67 0.92
68 0.92
69 0.91
70 0.92
71 0.89
72 0.88
73 0.85
74 0.82
75 0.8
76 0.74
77 0.69
78 0.59
79 0.55
80 0.45
81 0.39
82 0.31