Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DI85

Protein Details
Accession A0A319DI85   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-46ITKSPNPHPQHERIKKTKKQTSLHHydrophilic
100-127SGPYATKEPSRKNKNKNKNKNSEHDPAEHydrophilic
NLS Segment(s)
PositionSequence
113-113K
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MYPNATPQLPQNHQPPIQSGNQITKSPNPHPQHERIKKTKKQTSLHAYAPALAHPLSIPIRPTCSTPDMNITPLPSQHPETHKPYPGYTPPNPCPPSYLSGPYATKEPSRKNKNKNKNKNSEHDPAEISSVGRGLPRTASAHTTWNHGWVLDHQVDSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.41
4 0.41
5 0.4
6 0.37
7 0.38
8 0.4
9 0.4
10 0.39
11 0.4
12 0.43
13 0.43
14 0.5
15 0.47
16 0.51
17 0.56
18 0.62
19 0.68
20 0.71
21 0.75
22 0.76
23 0.81
24 0.81
25 0.84
26 0.83
27 0.81
28 0.76
29 0.76
30 0.75
31 0.71
32 0.66
33 0.61
34 0.53
35 0.46
36 0.41
37 0.31
38 0.23
39 0.17
40 0.14
41 0.08
42 0.11
43 0.1
44 0.11
45 0.12
46 0.11
47 0.15
48 0.16
49 0.18
50 0.18
51 0.21
52 0.21
53 0.21
54 0.25
55 0.23
56 0.24
57 0.23
58 0.2
59 0.17
60 0.16
61 0.18
62 0.14
63 0.16
64 0.18
65 0.22
66 0.26
67 0.32
68 0.35
69 0.38
70 0.37
71 0.35
72 0.36
73 0.36
74 0.39
75 0.37
76 0.41
77 0.39
78 0.47
79 0.48
80 0.44
81 0.41
82 0.36
83 0.36
84 0.31
85 0.31
86 0.23
87 0.26
88 0.27
89 0.25
90 0.24
91 0.22
92 0.24
93 0.27
94 0.34
95 0.4
96 0.5
97 0.59
98 0.67
99 0.76
100 0.83
101 0.89
102 0.91
103 0.92
104 0.92
105 0.9
106 0.88
107 0.85
108 0.82
109 0.75
110 0.67
111 0.58
112 0.48
113 0.42
114 0.34
115 0.26
116 0.18
117 0.14
118 0.11
119 0.11
120 0.11
121 0.1
122 0.11
123 0.13
124 0.16
125 0.17
126 0.21
127 0.21
128 0.27
129 0.27
130 0.32
131 0.29
132 0.31
133 0.29
134 0.25
135 0.25
136 0.21
137 0.28
138 0.25
139 0.26