Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319CTD9

Protein Details
Accession A0A319CTD9   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-78AEPSVDGVKKRKKRNRWGDAQENKAHydrophilic
NLS Segment(s)
PositionSequence
59-69DGVKKRKKRNR
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 3.5, cyto_pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032570  SF1-HH  
IPR047086  SF1-HH_sf  
Pfam View protein in Pfam  
PF16275  SF1-HH  
Amino Acid Sequences MAWRNQGITGSNNIPLGRRRFGGEDGPEDDSRTATPASAAGDSGYKRGRSPVRAEPSVDGVKKRKKRNRWGDAQENKAAGLMGLPTMIMANFTNEQLEAYTLHLRIEEISQKLRINDVVPADGDRYVLWIKFSLRMLTRMQVSLPSSPVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.33
4 0.31
5 0.3
6 0.31
7 0.32
8 0.35
9 0.39
10 0.36
11 0.35
12 0.34
13 0.38
14 0.35
15 0.33
16 0.3
17 0.23
18 0.2
19 0.17
20 0.14
21 0.09
22 0.09
23 0.09
24 0.11
25 0.1
26 0.1
27 0.08
28 0.11
29 0.11
30 0.14
31 0.16
32 0.15
33 0.15
34 0.22
35 0.27
36 0.28
37 0.34
38 0.4
39 0.44
40 0.46
41 0.47
42 0.41
43 0.42
44 0.42
45 0.37
46 0.32
47 0.32
48 0.39
49 0.45
50 0.54
51 0.58
52 0.63
53 0.73
54 0.8
55 0.82
56 0.83
57 0.84
58 0.84
59 0.82
60 0.76
61 0.67
62 0.56
63 0.47
64 0.37
65 0.28
66 0.17
67 0.1
68 0.06
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.06
86 0.08
87 0.11
88 0.11
89 0.11
90 0.11
91 0.11
92 0.11
93 0.13
94 0.15
95 0.15
96 0.18
97 0.21
98 0.22
99 0.23
100 0.23
101 0.22
102 0.18
103 0.2
104 0.19
105 0.17
106 0.16
107 0.17
108 0.16
109 0.15
110 0.14
111 0.1
112 0.12
113 0.12
114 0.12
115 0.12
116 0.14
117 0.15
118 0.2
119 0.22
120 0.24
121 0.25
122 0.28
123 0.3
124 0.33
125 0.34
126 0.3
127 0.29
128 0.28
129 0.29
130 0.28