Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8NKD8

Protein Details
Accession A8NKD8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
187-213TARVYNWDVKRRRERRLAKEAEEKEKAHydrophilic
NLS Segment(s)
PositionSequence
196-213KRRRERRLAKEAEEKEKA
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016655  PFD3  
IPR009053  Prefoldin  
IPR004127  Prefoldin_subunit_alpha  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0006457  P:protein folding  
KEGG cci:CC1G_02156  -  
Pfam View protein in Pfam  
PF02996  Prefoldin  
Amino Acid Sequences MAQTPKTVFSEEKNPRGIPKAPFIADVEEYLGGPDGDVEATLRTFQDAIAKYRYMDGSLTQRRASLEEKIPDIKKTLDMVEFIRDRKAGKSKSEDDEDDLDDEEDDGEPQPFKTTFELNDTLYAEAEIQDTDTVYLWLGANVMLSYPIPEAISLLQSKLDAANLTLSNTIEDLEFLREQLTIMEVNTARVYNWDVKRRRERRLAKEAEEKEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.52
4 0.53
5 0.47
6 0.46
7 0.46
8 0.42
9 0.43
10 0.41
11 0.39
12 0.34
13 0.3
14 0.23
15 0.17
16 0.16
17 0.14
18 0.13
19 0.09
20 0.07
21 0.07
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.14
34 0.16
35 0.19
36 0.23
37 0.23
38 0.23
39 0.26
40 0.26
41 0.19
42 0.17
43 0.17
44 0.23
45 0.29
46 0.32
47 0.29
48 0.3
49 0.3
50 0.32
51 0.31
52 0.28
53 0.27
54 0.27
55 0.3
56 0.34
57 0.35
58 0.33
59 0.32
60 0.27
61 0.23
62 0.22
63 0.21
64 0.16
65 0.16
66 0.16
67 0.2
68 0.21
69 0.19
70 0.19
71 0.18
72 0.18
73 0.21
74 0.29
75 0.26
76 0.3
77 0.36
78 0.39
79 0.43
80 0.45
81 0.41
82 0.36
83 0.34
84 0.3
85 0.23
86 0.19
87 0.15
88 0.11
89 0.1
90 0.07
91 0.05
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.07
98 0.07
99 0.08
100 0.09
101 0.11
102 0.11
103 0.16
104 0.18
105 0.16
106 0.18
107 0.18
108 0.16
109 0.15
110 0.14
111 0.09
112 0.07
113 0.07
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.07
148 0.07
149 0.11
150 0.11
151 0.12
152 0.13
153 0.13
154 0.12
155 0.12
156 0.12
157 0.07
158 0.08
159 0.08
160 0.1
161 0.1
162 0.1
163 0.11
164 0.1
165 0.1
166 0.1
167 0.11
168 0.07
169 0.08
170 0.13
171 0.12
172 0.14
173 0.15
174 0.15
175 0.14
176 0.15
177 0.19
178 0.23
179 0.3
180 0.38
181 0.44
182 0.54
183 0.65
184 0.71
185 0.77
186 0.79
187 0.82
188 0.82
189 0.87
190 0.85
191 0.82
192 0.84
193 0.82