Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DBQ5

Protein Details
Accession A0A319DBQ5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
3-48RYESKRATRKTGKEINPPRSKQTRPDRTPRGKKKKRNTIGIGKPWHBasic
NLS Segment(s)
PositionSequence
7-39KRATRKTGKEINPPRSKQTRPDRTPRGKKKKRN
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MVRYESKRATRKTGKEINPPRSKQTRPDRTPRGKKKKRNTIGIGKPWHMMCSRGVIPDSFDRPNQTPLSIDHINSGGWEVMMSVCMGEMNPNQYAGGGDRERIRRRRWGWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.82
4 0.82
5 0.82
6 0.78
7 0.76
8 0.74
9 0.7
10 0.69
11 0.71
12 0.71
13 0.68
14 0.76
15 0.78
16 0.81
17 0.88
18 0.9
19 0.9
20 0.89
21 0.92
22 0.92
23 0.93
24 0.91
25 0.89
26 0.86
27 0.85
28 0.84
29 0.82
30 0.75
31 0.65
32 0.59
33 0.49
34 0.43
35 0.33
36 0.25
37 0.17
38 0.17
39 0.17
40 0.15
41 0.16
42 0.14
43 0.15
44 0.17
45 0.2
46 0.16
47 0.16
48 0.18
49 0.2
50 0.24
51 0.22
52 0.2
53 0.18
54 0.18
55 0.25
56 0.22
57 0.21
58 0.18
59 0.17
60 0.17
61 0.15
62 0.15
63 0.08
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.07
75 0.08
76 0.11
77 0.12
78 0.12
79 0.12
80 0.12
81 0.13
82 0.12
83 0.18
84 0.16
85 0.18
86 0.25
87 0.34
88 0.43
89 0.49
90 0.53
91 0.56