Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RL10

Protein Details
Accession D6RL10   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPQNQQRKNPQHRESNPRPHRTSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG cci:CC1G_14020  -  
Amino Acid Sequences MPQNQQRKNPQHRESNPRPHRTSRGLKVSRILDARNPAQKNPSPNRPRNSNVDPRLVAINSSAAECGNSSLKKIRKSVSYMSQRRAIVYTKIFLSIWNRVRLRKALGIKLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.86
4 0.85
5 0.83
6 0.78
7 0.77
8 0.76
9 0.75
10 0.73
11 0.74
12 0.68
13 0.65
14 0.64
15 0.58
16 0.55
17 0.47
18 0.4
19 0.33
20 0.34
21 0.37
22 0.39
23 0.38
24 0.34
25 0.38
26 0.4
27 0.45
28 0.46
29 0.51
30 0.53
31 0.59
32 0.63
33 0.63
34 0.64
35 0.62
36 0.63
37 0.62
38 0.56
39 0.53
40 0.47
41 0.42
42 0.4
43 0.32
44 0.25
45 0.15
46 0.13
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.09
55 0.09
56 0.11
57 0.18
58 0.23
59 0.27
60 0.31
61 0.34
62 0.35
63 0.4
64 0.45
65 0.48
66 0.54
67 0.55
68 0.56
69 0.59
70 0.54
71 0.5
72 0.47
73 0.39
74 0.34
75 0.31
76 0.3
77 0.24
78 0.26
79 0.24
80 0.24
81 0.27
82 0.3
83 0.33
84 0.39
85 0.41
86 0.43
87 0.49
88 0.5
89 0.52
90 0.51
91 0.52