Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DDV2

Protein Details
Accession A0A319DDV2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-81PHASTQKKIQQKSKNIQQKGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 7
Family & Domain DBs
Amino Acid Sequences MGGSLWVCVLSTVFIVLIIEACREERRASCDSRWPKPSSSSSPSPTFFLPSSSISLLGVSGPHASTQKKIQQKSKNIQQKGFAGGHPPNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.06
7 0.06
8 0.08
9 0.09
10 0.1
11 0.12
12 0.13
13 0.18
14 0.22
15 0.26
16 0.27
17 0.36
18 0.41
19 0.46
20 0.51
21 0.49
22 0.47
23 0.48
24 0.51
25 0.49
26 0.48
27 0.46
28 0.44
29 0.45
30 0.44
31 0.4
32 0.34
33 0.29
34 0.23
35 0.2
36 0.17
37 0.15
38 0.16
39 0.15
40 0.15
41 0.12
42 0.12
43 0.1
44 0.08
45 0.07
46 0.05
47 0.06
48 0.05
49 0.07
50 0.1
51 0.11
52 0.13
53 0.2
54 0.27
55 0.35
56 0.41
57 0.5
58 0.57
59 0.66
60 0.74
61 0.78
62 0.8
63 0.78
64 0.76
65 0.72
66 0.66
67 0.63
68 0.55
69 0.45
70 0.42