FuNGI

A8N398

Protein Details

Accession

A8N398

Localization Confidence

Medium

Confidence Score

13.3

NoLS Segment(s)

Position	Sequence	Protein Nature
6-37	ANPADAYRKAQRKKELKKAGRNKAERAKARDF	Hydrophilic

NLS Segment(s)

Position	Sequence
13-35	RKAQRKKELKKAGRNKAERAKAR
116-116	K

Subcellular Location(s)

nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR019007 WW_dom-bd_prot_11
Gene Ontology	GO:0006396 P:RNA processing
KEGG	cci:CC1G_00522 -
Pfam	View protein in Pfam PF12622 NpwBP PF09429 Wbp11

Amino Acid Sequences

MAKKSANPADAYRKAQRKKELKKAGRNKAERAKARDFALVKKDTTELEEEIEKLEQEASSGGKPDPRLAELKAELEKINKKKAEYVEEHPEARKLVYRQRKRDTGNEAEAKPLPAKRNMFNKKGLPRHPERSIYYDPIMNPFGVPPPGMPYMERPLRPDEVDSDAEMDDDDDIPLPPGLPPGSEEVGSDEDIPLPEGPPPGRQIPQPPLPPLPPGIPPPPGMAGAPNFPTPPPPPGFPSSFPTGAPPPPPGMPVAGAPGVPPPPPGMPVAGAPGIPPPPPGMPFAGAPGVPPPPPGPPPMGMPPFQPQGWPVGVPPPPPGMPSFPPNMGQLPPPPPGFFPRKAQSASSMQDPLSSVPHQTFQAHRASQLAPPHPSLPAKPSPVATTISAPATTSATATVEAAPQLRDFKKEATAFVPSSLKRKKGAGGGGAGSGINTAPSVGEQAGKDIGPAKPDLVGTLKNQFPAPKPDDKPKDDYAKFMEEMGDILQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.67
2	0.72
3	0.76
4	0.76
5	0.8
6	0.84
7	0.86
8	0.87
9	0.9
10	0.92
11	0.93
12	0.93
13	0.89
14	0.88
15	0.87
16	0.86
17	0.84
18	0.82
19	0.78
20	0.72
21	0.68
22	0.66
23	0.58
24	0.55
25	0.55
26	0.51
27	0.43
28	0.41
29	0.4
30	0.33
31	0.34
32	0.3
33	0.23
34	0.22
35	0.23
36	0.21
37	0.21
38	0.2
39	0.17
40	0.14
41	0.14
42	0.1
43	0.09
44	0.1
45	0.11
46	0.11
47	0.14
48	0.14
49	0.17
50	0.18
51	0.23
52	0.24
53	0.25
54	0.27
55	0.27
56	0.32
57	0.31
58	0.34
59	0.32
60	0.31
61	0.29
62	0.32
63	0.4
64	0.39
65	0.46
66	0.45
67	0.44
68	0.48
69	0.53
70	0.56
71	0.52
72	0.53
73	0.54
74	0.55
75	0.56
76	0.5
77	0.46
78	0.38
79	0.33
80	0.32
81	0.27
82	0.33
83	0.41
84	0.5
85	0.58
86	0.66
87	0.73
88	0.72
89	0.76
90	0.75
91	0.72
92	0.71
93	0.69
94	0.6
95	0.56
96	0.52
97	0.46
98	0.41
99	0.37
100	0.32
101	0.32
102	0.36
103	0.39
104	0.49
105	0.55
106	0.56
107	0.59
108	0.63
109	0.65
110	0.7
111	0.71
112	0.69
113	0.69
114	0.71
115	0.71
116	0.68
117	0.62
118	0.61
119	0.58
120	0.54
121	0.47
122	0.43
123	0.37
124	0.34
125	0.32
126	0.24
127	0.19
128	0.16
129	0.16
130	0.14
131	0.13
132	0.1
133	0.13
134	0.15
135	0.15
136	0.15
137	0.17
138	0.24
139	0.29
140	0.3
141	0.28
142	0.31
143	0.33
144	0.33
145	0.3
146	0.25
147	0.25
148	0.25
149	0.22
150	0.2
151	0.17
152	0.16
153	0.14
154	0.12
155	0.07
156	0.06
157	0.06
158	0.05
159	0.05
160	0.06
161	0.06
162	0.06
163	0.05
164	0.07
165	0.07
166	0.06
167	0.07
168	0.1
169	0.11
170	0.11
171	0.11
172	0.12
173	0.13
174	0.14
175	0.13
176	0.1
177	0.09
178	0.09
179	0.1
180	0.08
181	0.07
182	0.08
183	0.09
184	0.1
185	0.11
186	0.14
187	0.16
188	0.17
189	0.19
190	0.23
191	0.27
192	0.34
193	0.35
194	0.35
195	0.35
196	0.35
197	0.34
198	0.3
199	0.26
200	0.21
201	0.21
202	0.21
203	0.2
204	0.2
205	0.2
206	0.2
207	0.18
208	0.16
209	0.14
210	0.12
211	0.12
212	0.12
213	0.12
214	0.11
215	0.1
216	0.13
217	0.13
218	0.16
219	0.17
220	0.17
221	0.2
222	0.23
223	0.26
224	0.25
225	0.27
226	0.27
227	0.26
228	0.24
229	0.23
230	0.22
231	0.2
232	0.2
233	0.17
234	0.15
235	0.15
236	0.15
237	0.13
238	0.11
239	0.1
240	0.09
241	0.1
242	0.08
243	0.08
244	0.07
245	0.08
246	0.09
247	0.08
248	0.08
249	0.08
250	0.08
251	0.09
252	0.1
253	0.09
254	0.09
255	0.09
256	0.1
257	0.09
258	0.09
259	0.08
260	0.09
261	0.09
262	0.09
263	0.09
264	0.08
265	0.09
266	0.1
267	0.12
268	0.11
269	0.12
270	0.12
271	0.13
272	0.12
273	0.11
274	0.1
275	0.1
276	0.11
277	0.09
278	0.1
279	0.1
280	0.12
281	0.13
282	0.15
283	0.16
284	0.16
285	0.19
286	0.25
287	0.26
288	0.24
289	0.25
290	0.27
291	0.27
292	0.25
293	0.22
294	0.16
295	0.18
296	0.18
297	0.16
298	0.12
299	0.16
300	0.18
301	0.18
302	0.2
303	0.19
304	0.18
305	0.19
306	0.2
307	0.19
308	0.19
309	0.22
310	0.23
311	0.21
312	0.23
313	0.23
314	0.24
315	0.2
316	0.2
317	0.21
318	0.22
319	0.25
320	0.24
321	0.24
322	0.23
323	0.28
324	0.33
325	0.32
326	0.35
327	0.36
328	0.4
329	0.41
330	0.41
331	0.4
332	0.39
333	0.38
334	0.34
335	0.31
336	0.26
337	0.26
338	0.25
339	0.21
340	0.19
341	0.17
342	0.15
343	0.14
344	0.16
345	0.17
346	0.18
347	0.2
348	0.2
349	0.27
350	0.26
351	0.26
352	0.27
353	0.27
354	0.28
355	0.33
356	0.34
357	0.29
358	0.31
359	0.31
360	0.31
361	0.31
362	0.29
363	0.29
364	0.31
365	0.32
366	0.32
367	0.32
368	0.31
369	0.32
370	0.32
371	0.27
372	0.23
373	0.22
374	0.21
375	0.2
376	0.17
377	0.16
378	0.15
379	0.13
380	0.11
381	0.1
382	0.09
383	0.09
384	0.1
385	0.09
386	0.09
387	0.1
388	0.11
389	0.11
390	0.12
391	0.18
392	0.19
393	0.21
394	0.23
395	0.25
396	0.32
397	0.32
398	0.33
399	0.3
400	0.34
401	0.31
402	0.33
403	0.36
404	0.3
405	0.38
406	0.42
407	0.43
408	0.4
409	0.43
410	0.44
411	0.45
412	0.49
413	0.44
414	0.42
415	0.4
416	0.37
417	0.34
418	0.29
419	0.21
420	0.16
421	0.11
422	0.07
423	0.05
424	0.05
425	0.04
426	0.05
427	0.07
428	0.07
429	0.11
430	0.11
431	0.13
432	0.15
433	0.15
434	0.15
435	0.18
436	0.18
437	0.18
438	0.19
439	0.17
440	0.17
441	0.18
442	0.19
443	0.19
444	0.21
445	0.22
446	0.28
447	0.3
448	0.29
449	0.32
450	0.34
451	0.35
452	0.42
453	0.44
454	0.47
455	0.5
456	0.59
457	0.67
458	0.68
459	0.7
460	0.69
461	0.74
462	0.65
463	0.65
464	0.6
465	0.57
466	0.51
467	0.46
468	0.39
469	0.28

A8N398

3D AlphaFold-predicted Structure Viewer