Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319DF16

Protein Details
Accession A0A319DF16    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-69AISSIKTELKQRRKQPRRSRPKIFEEHRERBasic
NLS Segment(s)
PositionSequence
49-61KQRRKQPRRSRPK
Subcellular Location(s) nucl 22, cyto_nucl 13.833, mito_nucl 11.833
Family & Domain DBs
Amino Acid Sequences MDYPCVKLFSGENLSFSWTSSFKEVRDPDLEAFLHQCCTAISSIKTELKQRRKQPRRSRPKIFEEHRERLGTCAAGIETSQELNDEQAKQAKIAVEIITTSQTTRFEKTYQDILNDISRLCGPELVLLCAAALGKHKISHLNKRDRLHLLDHLKKKESELKVSRLAALVDVYKIPKSLFKVSIINSLLSGVFYIYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.24
5 0.17
6 0.18
7 0.22
8 0.24
9 0.2
10 0.3
11 0.31
12 0.33
13 0.35
14 0.36
15 0.32
16 0.34
17 0.33
18 0.25
19 0.25
20 0.21
21 0.19
22 0.16
23 0.15
24 0.1
25 0.11
26 0.12
27 0.13
28 0.13
29 0.15
30 0.21
31 0.25
32 0.27
33 0.34
34 0.42
35 0.49
36 0.57
37 0.64
38 0.7
39 0.76
40 0.85
41 0.88
42 0.9
43 0.91
44 0.92
45 0.93
46 0.9
47 0.89
48 0.88
49 0.83
50 0.82
51 0.8
52 0.75
53 0.68
54 0.61
55 0.52
56 0.43
57 0.39
58 0.28
59 0.19
60 0.14
61 0.1
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.06
68 0.05
69 0.06
70 0.07
71 0.09
72 0.08
73 0.09
74 0.13
75 0.13
76 0.13
77 0.14
78 0.14
79 0.12
80 0.13
81 0.12
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.09
90 0.11
91 0.12
92 0.14
93 0.14
94 0.16
95 0.19
96 0.24
97 0.22
98 0.22
99 0.21
100 0.21
101 0.21
102 0.2
103 0.17
104 0.11
105 0.1
106 0.11
107 0.1
108 0.09
109 0.07
110 0.1
111 0.11
112 0.11
113 0.11
114 0.1
115 0.09
116 0.09
117 0.09
118 0.06
119 0.07
120 0.07
121 0.08
122 0.1
123 0.11
124 0.2
125 0.26
126 0.36
127 0.44
128 0.53
129 0.59
130 0.61
131 0.66
132 0.62
133 0.59
134 0.53
135 0.53
136 0.51
137 0.53
138 0.58
139 0.57
140 0.56
141 0.53
142 0.53
143 0.53
144 0.48
145 0.49
146 0.48
147 0.49
148 0.52
149 0.53
150 0.5
151 0.42
152 0.38
153 0.28
154 0.24
155 0.19
156 0.13
157 0.14
158 0.14
159 0.14
160 0.14
161 0.14
162 0.17
163 0.21
164 0.27
165 0.28
166 0.31
167 0.36
168 0.38
169 0.46
170 0.43
171 0.38
172 0.31
173 0.29
174 0.25
175 0.19
176 0.17