Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DRS8

Protein Details
Accession A0A319DRS8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-69GRSLSKSQKAERKKKKKKITHTPNSFISTHydrophilic
NLS Segment(s)
PositionSequence
15-58SKKKGDDKGEGEKGQLKIVRGYPSEAGRSLSKSQKAERKKKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 15.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MNCVIPIQIPPKENSKKKGDDKGEGEKGQLKIVRGYPSEAGRSLSKSQKAERKKKKKKITHTPNSFISTIRSLYKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.61
4 0.66
5 0.74
6 0.7
7 0.68
8 0.67
9 0.7
10 0.68
11 0.59
12 0.53
13 0.48
14 0.43
15 0.38
16 0.34
17 0.26
18 0.22
19 0.25
20 0.27
21 0.22
22 0.23
23 0.22
24 0.22
25 0.22
26 0.2
27 0.18
28 0.15
29 0.18
30 0.2
31 0.23
32 0.27
33 0.28
34 0.34
35 0.41
36 0.5
37 0.58
38 0.65
39 0.72
40 0.78
41 0.86
42 0.91
43 0.92
44 0.93
45 0.93
46 0.93
47 0.93
48 0.92
49 0.88
50 0.83
51 0.77
52 0.67
53 0.56
54 0.49
55 0.41
56 0.34