Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319D697

Protein Details
Accession A0A319D697    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MCAPRTERKKERKKGRGSGSSLTRBasic
NLS Segment(s)
PositionSequence
7-17ERKKERKKGRG
Subcellular Location(s) mito 9, plas 6, nucl 4, extr 3, vacu 3
Family & Domain DBs
Amino Acid Sequences MCAPRTERKKERKKGRGSGSSLTRTHVHFPFLPGLTFFPPPPSFLIFLLLPPSLSPSLFLPCLPACLSPRFLPFGPGGAGAGAGGHERTRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.89
4 0.83
5 0.81
6 0.77
7 0.74
8 0.64
9 0.57
10 0.48
11 0.41
12 0.41
13 0.34
14 0.3
15 0.24
16 0.26
17 0.28
18 0.26
19 0.24
20 0.19
21 0.2
22 0.18
23 0.18
24 0.16
25 0.16
26 0.15
27 0.16
28 0.17
29 0.17
30 0.16
31 0.15
32 0.17
33 0.12
34 0.12
35 0.13
36 0.11
37 0.09
38 0.08
39 0.1
40 0.08
41 0.08
42 0.09
43 0.08
44 0.11
45 0.11
46 0.11
47 0.12
48 0.12
49 0.14
50 0.14
51 0.15
52 0.15
53 0.18
54 0.22
55 0.21
56 0.23
57 0.26
58 0.25
59 0.25
60 0.23
61 0.22
62 0.2
63 0.18
64 0.16
65 0.12
66 0.11
67 0.08
68 0.08
69 0.06
70 0.05
71 0.06