Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DR12

Protein Details
Accession A0A319DR12    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-106MMCGPRFTHKPPRKKVRPLLLKTTRHEHydrophilic
NLS Segment(s)
PositionSequence
91-94PRKK
Subcellular Location(s) nucl 7mito 7mito_nucl 7, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLADLTVSTRCDSIVVADSHTRCVYISLQCGIMAFILTMLGRRLVLSTRYQQFLVTIRTSLLGSERSWTEYLPSIPVIFMMCGPRFTHKPPRKKVRPLLLKTTRHETDHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.22
5 0.23
6 0.26
7 0.26
8 0.23
9 0.17
10 0.19
11 0.2
12 0.18
13 0.2
14 0.18
15 0.19
16 0.18
17 0.18
18 0.16
19 0.13
20 0.09
21 0.06
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.07
32 0.09
33 0.12
34 0.18
35 0.2
36 0.22
37 0.22
38 0.21
39 0.21
40 0.22
41 0.22
42 0.16
43 0.13
44 0.12
45 0.13
46 0.12
47 0.11
48 0.1
49 0.08
50 0.08
51 0.1
52 0.1
53 0.12
54 0.12
55 0.12
56 0.12
57 0.13
58 0.14
59 0.13
60 0.14
61 0.11
62 0.11
63 0.11
64 0.1
65 0.08
66 0.09
67 0.12
68 0.12
69 0.13
70 0.14
71 0.19
72 0.22
73 0.28
74 0.38
75 0.43
76 0.53
77 0.62
78 0.72
79 0.77
80 0.85
81 0.88
82 0.88
83 0.9
84 0.87
85 0.87
86 0.86
87 0.84
88 0.78
89 0.77
90 0.7