Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319CVH3

Protein Details
Accession A0A319CVH3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-34SDHSSIRKLARQKQCRRRTNMIKKAYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MVTIKKDSDHSSIRKLARQKQCRRRTNMIKKAYEYSNICNTDIYVGIRMQETGQVYILSADPSGFWAFLSSHLSLYYPTPNLVADDSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.59
4 0.62
5 0.69
6 0.73
7 0.76
8 0.83
9 0.86
10 0.87
11 0.88
12 0.88
13 0.89
14 0.88
15 0.86
16 0.8
17 0.73
18 0.69
19 0.6
20 0.55
21 0.46
22 0.41
23 0.39
24 0.36
25 0.33
26 0.29
27 0.27
28 0.21
29 0.2
30 0.16
31 0.09
32 0.07
33 0.08
34 0.08
35 0.08
36 0.07
37 0.09
38 0.09
39 0.08
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.07
46 0.06
47 0.05
48 0.05
49 0.07
50 0.08
51 0.07
52 0.06
53 0.07
54 0.08
55 0.1
56 0.14
57 0.13
58 0.13
59 0.13
60 0.14
61 0.13
62 0.15
63 0.18
64 0.15
65 0.15
66 0.15
67 0.16
68 0.17
69 0.19