Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319EEH4

Protein Details
Accession A0A319EEH4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-39LIIPITTVKKKPRRRSNTRNPQREYQEQHydrophilic
NLS Segment(s)
PositionSequence
20-26KKKPRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MTYMTIDGPCALIIPITTVKKKPRRRSNTRNPQREYQEQHEQKYRFYYTSGYGIKLIHNILVHSTRNSLKSTSHVYYQHHRHEQHEQHEHGHHNQPSQPQSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.18
4 0.22
5 0.27
6 0.37
7 0.47
8 0.57
9 0.65
10 0.7
11 0.77
12 0.84
13 0.9
14 0.92
15 0.93
16 0.94
17 0.93
18 0.87
19 0.84
20 0.8
21 0.77
22 0.72
23 0.68
24 0.68
25 0.62
26 0.6
27 0.6
28 0.54
29 0.47
30 0.45
31 0.4
32 0.29
33 0.26
34 0.24
35 0.18
36 0.24
37 0.24
38 0.2
39 0.19
40 0.19
41 0.18
42 0.17
43 0.16
44 0.1
45 0.1
46 0.09
47 0.1
48 0.13
49 0.13
50 0.13
51 0.16
52 0.16
53 0.18
54 0.2
55 0.19
56 0.17
57 0.2
58 0.26
59 0.25
60 0.28
61 0.3
62 0.33
63 0.4
64 0.47
65 0.53
66 0.54
67 0.54
68 0.53
69 0.6
70 0.63
71 0.64
72 0.64
73 0.57
74 0.54
75 0.58
76 0.58
77 0.53
78 0.55
79 0.48
80 0.44
81 0.46
82 0.48
83 0.49