Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319E2E4

Protein Details
Accession A0A319E2E4   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-26LDGSGHRKKHRRESWAIRRTPPBasic
NLS Segment(s)
PositionSequence
11-16RKKHRR
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAGWLDGSGHRKKHRRESWAIRRTPPCHVGASRVAKAPQPVPTGPLGAGMKPEAEEEDEMSYAPGSGLHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.76
4 0.8
5 0.82
6 0.83
7 0.8
8 0.77
9 0.76
10 0.7
11 0.66
12 0.59
13 0.49
14 0.44
15 0.4
16 0.36
17 0.36
18 0.38
19 0.33
20 0.31
21 0.29
22 0.27
23 0.28
24 0.26
25 0.23
26 0.22
27 0.2
28 0.21
29 0.21
30 0.2
31 0.18
32 0.21
33 0.17
34 0.13
35 0.14
36 0.12
37 0.12
38 0.11
39 0.12
40 0.08
41 0.1
42 0.1
43 0.11
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.09
50 0.08